KEGG   Pseudomonas putida DOT-T1E: T1E_0642Help
Entry
T1E_0642          CDS       T02181                                 

Gene name
tpiA
Definition
Triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ppx  Pseudomonas putida DOT-T1E
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ppx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    T1E_0642 (tpiA)
   01230 Biosynthesis of amino acids
    T1E_0642 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    T1E_0642 (tpiA)
   00051 Fructose and mannose metabolism
    T1E_0642 (tpiA)
   00562 Inositol phosphate metabolism
    T1E_0642 (tpiA)
Enzymes [BR:ppx01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     T1E_0642 (tpiA)
Exosome [BR:ppx04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   T1E_0642 (tpiA)
  Exosomal proteins of bladder cancer cells
   T1E_0642 (tpiA)
  Exosomal proteins of melanoma cells
   T1E_0642 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(725601..726344)
Genome map
AA seq 247 aa AA seqDB search
MVAGNWKMHGTRASVAELTKGLSNLALPSGVEVAVFPPALFINQVIDGLAGKEITVGAQN
SAVQPEQGALTGEVAPEQLVEAGCKLVLIGHSERRQIIGETDEVLNRKFAAAQAKGLKPV
LCIGETLEEREAGKTLEVVGRQLSSIIEAFGVKAFADAVIAYEPVWAIGTGLTATPQQAQ
DVHAAIRGQLAAEDAEVAAKVQLLYGGSVKAANAAELFGMPDIDGGLIGGASLNADEFGA
ICRAAGN
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atggtagctggtaactggaaaatgcacggtacccgcgctagcgtcgctgagctgaccaaa
ggcttgagcaatctcgccttgccgagcggagtggaagtcgccgtatttccaccggccttg
ttcatcaatcaggtgattgatggtctggcgggtaaagaaattactgtcggcgcacagaat
tctgctgtacaacccgaacagggtgcgctgaccggggaagttgctcccgagcagctggtt
gaagcaggttgcaagttggtgttgattggtcactcggagcgtcgccagattattggtgaa
accgacgaagtgctcaatcgcaagtttgcagcggcccaggccaaaggcttgaagccagtg
ctttgcataggggaaacccttgaggagcgcgaggctggcaaaacgctcgaagttgtcggg
cgtcaactaagcagtatcatcgaagcattcggtgttaaggcttttgccgatgcagtaatt
gcctatgagcctgtatgggccatcggtacaggccttacggccacgccacagcaggcccag
gatgtgcacgccgccatccgcggccagttggcggcagaagatgctgaagtggctgcgaag
gtgcagttgctatacggcggcagcgtgaaggcggccaatgcggccgaactgttcggcatg
ccggatatcgatggggggctcattggtggggcttccctgaacgcagacgaattcggtgca
atttgtcgcgccgcaggaaactga

DBGET integrated database retrieval system