KEGG   Pseudomonas putida DOT-T1E: T1E_0642Help
Entry
T1E_0642          CDS       T02181                                 

Gene name
tpiA
Definition
(GenBank) Triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ppx  Pseudomonas putida DOT-T1E
Pathway
ppx00010  Glycolysis / Gluconeogenesis
ppx00051  Fructose and mannose metabolism
ppx00562  Inositol phosphate metabolism
ppx01100  Metabolic pathways
ppx01110  Biosynthesis of secondary metabolites
ppx01120  Microbial metabolism in diverse environments
ppx01130  Biosynthesis of antibiotics
ppx01200  Carbon metabolism
ppx01230  Biosynthesis of amino acids
Module
ppx_M00002  Glycolysis, core module involving three-carbon compounds
ppx_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ppx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    T1E_0642 (tpiA)
   00051 Fructose and mannose metabolism
    T1E_0642 (tpiA)
   00562 Inositol phosphate metabolism
    T1E_0642 (tpiA)
Enzymes [BR:ppx01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     T1E_0642 (tpiA)
Exosome [BR:ppx04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   T1E_0642 (tpiA)
  Exosomal proteins of bladder cancer cells
   T1E_0642 (tpiA)
  Exosomal proteins of melanoma cells
   T1E_0642 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AFO46500
UniProt: I7AV62
Position
complement(725601..726344)
Genome map
AA seq 247 aa AA seqDB search
MVAGNWKMHGTRASVAELTKGLSNLALPSGVEVAVFPPALFINQVIDGLAGKEITVGAQN
SAVQPEQGALTGEVAPEQLVEAGCKLVLIGHSERRQIIGETDEVLNRKFAAAQAKGLKPV
LCIGETLEEREAGKTLEVVGRQLSSIIEAFGVKAFADAVIAYEPVWAIGTGLTATPQQAQ
DVHAAIRGQLAAEDAEVAAKVQLLYGGSVKAANAAELFGMPDIDGGLIGGASLNADEFGA
ICRAAGN
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atggtagctggtaactggaaaatgcacggtacccgcgctagcgtcgctgagctgaccaaa
ggcttgagcaatctcgccttgccgagcggagtggaagtcgccgtatttccaccggccttg
ttcatcaatcaggtgattgatggtctggcgggtaaagaaattactgtcggcgcacagaat
tctgctgtacaacccgaacagggtgcgctgaccggggaagttgctcccgagcagctggtt
gaagcaggttgcaagttggtgttgattggtcactcggagcgtcgccagattattggtgaa
accgacgaagtgctcaatcgcaagtttgcagcggcccaggccaaaggcttgaagccagtg
ctttgcataggggaaacccttgaggagcgcgaggctggcaaaacgctcgaagttgtcggg
cgtcaactaagcagtatcatcgaagcattcggtgttaaggcttttgccgatgcagtaatt
gcctatgagcctgtatgggccatcggtacaggccttacggccacgccacagcaggcccag
gatgtgcacgccgccatccgcggccagttggcggcagaagatgctgaagtggctgcgaag
gtgcagttgctatacggcggcagcgtgaaggcggccaatgcggccgaactgttcggcatg
ccggatatcgatggggggctcattggtggggcttccctgaacgcagacgaattcggtgca
atttgtcgcgccgcaggaaactga

DBGET integrated database retrieval system