KEGG   Pseudomonas putida DOT-T1E: T1E_0733Help
Entry
T1E_0733          CDS       T02181                                 

Gene name
recR
Definition
Recombination protein recR
Orthology
K06187  
recombination protein RecR
Organism
ppx  Pseudomonas putida DOT-T1E
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:ppx03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(832555..833157)
Genome map
AA seq 200 aa AA seqDB search
MSFSPLIRQLIDGLRILPGVGQKTAQRMALQLLERDRSGGLRLAQALTQAMEGVGHCRQC
RTLTEQELCPQCADPRRDDTQLCVVEGPTDVYAVEQTGYRGRYFVLKGHLSPLDGLGPEA
IGIPQLMARIEEQGTFTEVILATNPTVEGEATAHYIAQLLSEKGLVASRIAHGVPLGGEL
EMVDGGTLAHAFAGRRPISL
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgagcttcagccctctcatccgccaactgatcgacggcctgcgcatcttgccaggcgtt
ggccagaaaaccgcccagcgcatggccctgcaactgctcgagcgcgaccgcagtggcggg
ctgcgcctggctcaggccttgacccaggccatggaaggggtagggcattgccgccagtgt
cgcaccctcaccgagcaggaactgtgcccgcagtgcgccgacccgcgccgtgacgacacc
cagctgtgcgtggtcgaggggccgaccgatgtgtatgcggtggagcagacgggctaccgt
ggccgttacttcgtgctcaaggggcacctgtcgccgctggatggcctggggcctgaggcg
atcggtattccgcagctgatggcgcggatcgaagagcagggcacctttaccgaggtgatc
ctggcgaccaacccgacggtggagggggaggcgacggcgcattacattgcccagttgctg
agcgagaaaggcttggtggcgtctcgcattgcccatggtgtgccgctgggcggtgagctg
gagatggtggacggtggtaccttggcccatgcctttgcagggcgccggcccatttcgctc
tga

DBGET integrated database retrieval system