KEGG   Pseudomonas putida DOT-T1E: T1E_0746Help
Entry
T1E_0746          CDS       T02181                                 

Gene name
proB
Definition
(GenBank) Glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
ppx  Pseudomonas putida DOT-T1E
Pathway
ppx00330  Arginine and proline metabolism
ppx00332  Carbapenem biosynthesis
ppx01100  Metabolic pathways
ppx01130  Biosynthesis of antibiotics
ppx01230  Biosynthesis of amino acids
Module
ppx_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:ppx00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    T1E_0746 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    T1E_0746 (proB)
Enzymes [BR:ppx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     T1E_0746 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: AFO46604
UniProt: I7C4M6
Position
complement(851516..852634)
Genome map
AA seq 372 aa AA seqDB search
MRSKVTGAKRWVVKIGSALLTADGKGLDRGAMAVWVEQMVALREAGVELVLVSSGAVAAG
MSQLGWTKRPSAMNELQAAASLGQMRLVQAWESSFGEHGKHTAQILLTHDDLSDRKRYLN
ARSTLRTLVDLGVVPVINENDTVVTDEIRFGDNDTLAALVANLVEADLLVILTDRDGMFD
ADPRNNPEAQLIYEARADDPSLDAVAGGTGGALGRGGMQTKLRAARLAARSGAHTIIIGG
RIERVLDRLKAGERLGTLLSPERGMLAARKQWLAGHLQTRGTLVLDAGAVQALRQANKSL
LPVGVKTVQGSFRRGEMVVCVGPDGVEVARGLANYSALEAQKIIGQSSEAIESILGYSAE
PELVHRDNLVLV
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgcgaagcaaggtgacgggcgccaagcgctgggtcgttaagattggcagtgctctgctg
accgccgatggcaagggcctcgaccgcggtgcaatggccgtttgggtcgagcagatggtc
gcgctgcgtgaggcaggcgtggagttggtactggtctcctccggggccgtggctgccggc
atgagccagctgggctggaccaagcgaccgagtgcgatgaacgagctgcaggcggctgcc
tcgctcggccagatgcgcctggtgcaggcctgggagtcgagcttcggggagcatgggaag
cacaccgcgcagatcctgctgacccatgacgacctgtccgaccgcaagcgttacctgaat
gcccgcagcaccctgcgcaccttggtcgatctgggtgtggtgccggtgatcaacgaaaac
gacaccgtggtcaccgacgagatccgctttggcgacaacgacaccctggcggcgctggtg
gccaacctggtcgaggccgacctgctggtgatcctcaccgaccgcgatggtatgttcgat
gccgacccgcgcaacaaccccgaggcgcagttgatctacgaagcccgtgccgacgacccc
tcgctggatgccgtggccggtggtaccggtggtgccctgggccgtggcggcatgcagacc
aagctgcgtgcggcgcgcctggctgcccgttccggtgcccacaccatcattatcggtggc
cgcatcgagcgtgtgctggaccgtctgaaggcaggcgagcgcctgggcaccttgctgtcc
cctgagcgtggcatgctcgctgcgcgcaagcagtggctggccggtcacctgcaaacccgt
ggcaccctagtgctggatgccggtgccgtgcaagcgctgcgtcaggccaacaagagcttg
ctgccggttggtgtgaagacagtgcagggtagcttccgtcgtggcgagatggtggtgtgc
gtcggcccggacggtgttgaagtggctcgcggcctggccaactacagcgccctggaggcg
cagaagatcattggtcagtcgtccgaagccatcgagtcgatccttggctatagcgccgag
ccggaacttgtacaccgcgacaacctggtgctggtatga

DBGET integrated database retrieval system