KEGG   Pseudomonas putida DOT-T1E: T1E_0773Help
Entry
T1E_0773          CDS       T02181                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
ppx  Pseudomonas putida DOT-T1E
Pathway
ppx00260  Glycine, serine and threonine metabolism
ppx00750  Vitamin B6 metabolism
ppx01100  Metabolic pathways
ppx01110  Biosynthesis of secondary metabolites
ppx01120  Microbial metabolism in diverse environments
ppx01230  Biosynthesis of amino acids
Module
ppx_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ppx00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    T1E_0773 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    T1E_0773 (thrC)
Enzymes [BR:ppx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     T1E_0773 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: AFO46631
UniProt: I7C0N1
Position
complement(879796..881184)
Genome map
AA seq 462 aa AA seqDB search
MQYTSTRGNETRVDFRTALLSGLADDGGLYVPTSVPVFSPQEIASWSWLPFDELAWRVMA
PFVGDTLDEPTLRALVSDSYRGFRHRGIAPLQQLGHNEWILQLFHGPTRSSKDFAAQLQA
RFVRHFLGAECERVMLVGASNGDTAVAAIEALRHCPAAGLLALYPSAGTPADRAAVMRSA
ASDSVSCVAVDGSFDDCQSLVSALLRDWPCPGLIPVSFNSTNWVGVLAQIVFYFHAALQL
GGGIRPVGFSIPTASFAEIYAGFIAQKMGLPINQIIVSTNRNDALHRFIHCNRYSRGSTS
QTLSPVMDFSLFSNLERFVWELYDRDGGATRALMEHFEACGELSIGNRQWLHARMLFDSY
AVDDVLIREEIVTLFHETGSAVDPHAATGVFAGRLHRRNIGAPIVTLGQFAPEKSAGLLA
ELGAWHGEVPAGAVGTAGDGPLLAPDDLAGVHALLARLQAGR
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgcagtacacatccacgcgcggcaacgagacacgggtcgatttccgcacggcattgctt
tctggcctggccgacgatggcgggctttatgtgcccacctcggtgccggtgttcagccca
caggaaattgccagctggtcgtggttgcccttcgacgaactggcctggcgggtaatggca
ccgtttgtcggcgataccctcgacgagcctacgctcagggcgctggtcagcgacagctat
cgcgggttccgccaccgcggcattgcgccgttgcagcagcttggccataacgaatggatc
ctgcagcttttccatggccctacccggtcctccaaggactttgccgcgcagttgcaggcg
cgctttgtccggcactttctgggggcggagtgcgagcgggtcatgctggtcggtgccagc
aacggcgataccgcagtagcggctatcgaagcgctgcggcattgccctgcagcaggcttg
ctggcgctatacccgagcgcaggcacgcccgccgaccgcgcggcagtgatgcgcagtgcc
gcgtccgacagcgtgagctgcgtggccgtggatggcagttttgacgattgccagtcgctg
gtgtcggcgctgctgcgtgactggccttgccccgggctgattccggtcagcttcaactcc
accaactgggtcggtgtgctggcgcagatcgtgttctatttccatgcggcgctgcagctc
ggtggcgggatacgcccggtcgggttcagcatccccacggccagttttgccgagatctac
gcggggttcattgcccagaaaatgggcctgccgatcaaccagatcatcgtctccaccaac
cgcaacgatgccctgcaccggttcatccactgcaaccgctacagccgtggctccaccagc
cagaccttgtcaccggtcatggacttttcgctgttctccaacctggagcgcttcgtctgg
gaactgtatgaccgcgatggcggggcaacccgggcactgatggagcacttcgaggcgtgt
ggcgagctgagcatcggcaaccgccagtggttgcatgcgcgcatgctgttcgactcctat
gccgtggacgacgtgctgattcgcgaagaaattgtcaccctgttccacgaaacgggcagc
gcagtagaccctcatgccgcgacaggggtattcgccgggcgcctgcaccggcgcaacatc
ggtgcgcccatcgtcacgctggggcagtttgcccccgaaaagtctgccgggctgctggcg
gagctgggggcctggcacggtgaggtgcccgccggtgcggtcggcacagcgggcgatggg
ccgctgttggcacctgacgacctggccggtgttcatgccttgttggcccggttgcaggct
gggcgatga

DBGET integrated database retrieval system