KEGG   Pseudomonas putida DOT-T1E: T1E_0907Help
Entry
T1E_0907          CDS       T02181                                 

Gene name
trpA
Definition
(GenBank) Tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ppx  Pseudomonas putida DOT-T1E
Pathway
ppx00260  Glycine, serine and threonine metabolism
ppx00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ppx01100  Metabolic pathways
ppx01110  Biosynthesis of secondary metabolites
ppx01130  Biosynthesis of antibiotics
ppx01230  Biosynthesis of amino acids
Module
ppx_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ppx00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    T1E_0907 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    T1E_0907 (trpA)
Enzymes [BR:ppx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     T1E_0907 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB PEP_mutase ThiG KDGP_aldolase PA BtpA Pterin_bind
Motif
Other DBs
NCBI-ProteinID: AFO46765
UniProt: I7AVT6
Position
complement(1030796..1031605)
Genome map
AA seq 269 aa AA seqDB search
MSRLEQRFAELKAEGRSALVTFVTAGDPGYDASLQILKGLPAAGADVIELGMPFTDPMAD
GVAIQLATLRALEAGQTLAKTLQMVREFRVDNQTTPIVLMGYYNPIHRFGVDTFVAQAKA
AGVDGLIIVDLPPEHDAELATPAQAAGIDFIRLTTPTTDDARLPRVLERSSGFVYYVSVA
GVTGAGSATTEHVTEAIARLRRHTDLPISVGFGIRTPEQAANIARLADGVVVGSALVDKI
AQAQSADQAVTDVLSLCSALAEGVRGARR
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgagccgtcttgaacaacgcttcgccgagctgaaggccgaaggccgctcggcactggtc
accttcgtcacagctggcgacccgggctacgacgcctcgttgcagatcctcaagggcctg
ccggctgctggcgccgacgtgatcgagctgggcatgccgttcaccgacccgatggccgat
ggcgtggccatccagctggccaccctgcgcgcccttgaggctggtcagaccttggccaag
accctgcagatggttcgcgaattccgtgtggataaccagaccacgccgatcgtgctgatg
ggctactacaaccctatccaccgctttggtgtggacacgttcgtggctcaagccaaggcc
gcgggcgtcgatggcctgatcatcgtcgaccttccgccagagcacgacgccgaactggct
accccggcccaggctgcaggcatcgacttcatccgcctgaccaccccgaccaccgacgac
gcgcgcctgccgcgcgtgctggagcgcagctccgggttcgtctactacgtgtcggtggct
ggtgtaaccggtgcaggttcggcgaccaccgagcatgtgaccgaagccattgcccgcctg
cgccggcataccgatctgccgatcagcgttggcttcggcattcgcacgccggaacaggct
gcgaacattgcccgcctggccgatggcgtggtggtgggctcggcactggtcgacaagatc
gcccaagcccaaagcgccgatcaggcggtgaccgatgtattgagcctgtgctcggcattg
gctgaaggggtgcgtggcgcacgccgctaa

DBGET integrated database retrieval system