KEGG   Pseudomonas putida DOT-T1E: T1E_0908Help
Entry
T1E_0908          CDS       T02181                                 

Definition
Tryptophan synthase beta chain
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ppx  Pseudomonas putida DOT-T1E
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ppx00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    T1E_0908
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    T1E_0908
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    T1E_0908
Enzymes [BR:ppx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     T1E_0908
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1031602..1032819)
Genome map
AA seq 405 aa AA seqDB search
MTQSQYRPGPDANGLFGSFGGRYVAETLMPLVLDLAREYEAAKADPKFLEELAYFQRDYI
GRPNPLYFAERLTEHCGGAKIFFKREELNHTGAHKVNNCIGQVLLAKRMGKKRLIAETGA
GMHGVATATVAARFGLPCVIYMGATDIERQQANVFRMKLLGAEIVPVTAGTGTLKDAMNE
ALRDWVTNVEDTFYLIGTVAGPHPYPAMVRDFQSIIGKETRAQLQEKEGRLPDSLVACVG
GGSNAMGLFHEFLEEPSVQIIGVEAGGHGVHTDKHAASLNGGVPGVLHGNRTYLLQDQDG
QITDAHSISAGLDYPGIGPEHAYLHEVKRVEYVSITDDEALDAFHATCRLEGIIPALESS
HALAEAIKRAPKLPKDHLMVVCLSGRGDKDMQTVMNHMAAQEKHA
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgacccagtcccaataccgccccggccccgacgccaatggcctgttcggctcgttcggc
ggccgctacgtggccgaaaccctgatgccactggtgctggacctggcccgcgaatacgaa
gcggccaaggcagaccccaagttccttgaagagctggcttactttcagcgcgactacatc
ggccgccccaacccgctgtacttcgccgagcgcctgaccgagcattgcggcggggcgaag
attttcttcaagcgtgaagagctcaaccataccggcgcgcacaaggtgaacaactgcatc
ggccaagtgctgctggccaagcgcatgggcaaaaagcgcctgatcgccgaaaccggcgcc
ggcatgcacggtgtcgccaccgccaccgtcgccgcgcgcttcggcctgccttgcgtgatc
tacatgggcgccaccgacatcgagcgccagcaggcgaacgtgttccgcatgaagctgctg
ggcgccgagatcgtgccggttaccgccggcaccggcaccctgaaagacgccatgaacgaa
gccctgcgtgactgggttaccaacgtcgaagacaccttctacctgatcggcaccgtggct
ggcccacacccgtaccccgccatggtccgcgatttccagtcgatcatcggcaaagagacc
cgtgcccagttgcaagagaaggaaggccgtctgccagacagcctggttgcctgcgtcggc
ggcggctccaatgccatgggcctgttccatgagttcctcgaagagccgagcgtgcagatc
atcggcgttgaagccggtggccacggcgtacacaccgacaagcatgccgccagcctgaac
ggcggcgtaccgggcgtattgcacggcaaccgcacctacctgctgcaggaccaagacggc
cagatcaccgatgcccactcgatttccgcaggcctggactacccgggcatcggcccggag
cacgcctatctgcatgaggtgaagcgcgtcgagtacgtcagcatcaccgatgacgaagca
ttggatgcgttccacgcaacctgccgtctggaaggcatcattccagccctggaaagctcc
cacgccttggccgaagcgatcaagcgcgcaccgaagctgcccaaggaccacctgatggtc
gtgtgcctgtctggccgcggcgacaaagacatgcaaaccgtcatgaaccacatggccgcc
caggagaaacacgcatga

DBGET integrated database retrieval system