KEGG   Pseudomonas putida DOT-T1E: T1E_1107Help
Entry
T1E_1107          CDS       T02181                                 

Gene name
pyrB
Definition
Aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
ppx  Pseudomonas putida DOT-T1E
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:ppx00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:ppx00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1261176..1262180)
Genome map
AA seq 334 aa AA seqDB search
MTPIDAKRPLQLNDQGQLRHFLSLDGLPRELLTEILDTADSFLEVGARAVKKVPLLRGKT
VCNVFFENSTRTRTTFELAAQRLSADVISLNVSTSSTSKGETLFDTLRNLEAMAADMFVV
RHSDSGAAHFIAEHVCPEVAVINGGDGRHAHPTQGMLDMLTIRRHKGSFENLSVAIVGDI
LHSRVARSDMLALKALGCPDIRVIGPKTLIPIGIEQYGVKVYTDLAEGLKDVDVVIMLRL
QRERMAGGLLPSEGEFYRLFGLTTARLAGAKPDAIVMHPGPINRGVEIESAVADGKHSVI
LNQVTYGIAVRMAVLSMAMSGQNAQRQLDQENAQ
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgacgccaatcgacgccaagcgcccgctgcagctcaatgatcagggccagctgcgccac
ttcctctcgcttgacggtttgcctcgcgaactgctcaccgagatcctcgacaccgccgac
tccttcctggaagtcggtgcccgggctgtgaaaaaagtcccgttgctgcgcggcaagact
gtgtgcaacgtgttcttcgagaactcgacccgtacccgtaccaccttcgaactggcagcc
cagcgcctgtcggccgacgtgatcagcctgaacgtgtcgacctcctcgaccagcaagggc
gaaaccctgttcgacaccctgcgcaacctcgaagccatggccgccgacatgttcgtcgta
cgccactccgactccggcgccgcgcacttcatcgccgagcacgtgtgcccggaagtggcc
gtgatcaacggcggtgacggccgccacgcgcacccgacccagggcatgctcgacatgctc
accatccgccgtcacaaaggcagcttcgaaaacctgtccgtggctatcgtcggcgacatc
ctgcactcgcgtgtggcccgttccgacatgctcgcgctcaaagcgctgggttgcccggac
atccgcgtgatcgggccgaaaaccctgatcccgatcggtatcgagcagtacggcgtaaag
gtctacaccgacctcgccgaaggcctgaaagacgtcgacgtggtgatcatgctgcgcctg
cagcgtgagcgcatggccggtggcctgctgcccagtgaaggcgagttctaccgcctgttc
ggcctgacgaccgcgcgcctggccggggccaagcctgacgccatcgtcatgcacccgggc
ccgatcaaccgtggcgtagaaatcgagtcggcggtagccgatggcaagcactcggtgatc
ctcaaccaggtcacctacggtatcgccgtgcgcatggccgtgctgtccatggccatgagc
gggcagaacgcgcaacgtcaattggaccaggagaacgcccagtga

DBGET integrated database retrieval system