KEGG   Pseudomonas putida DOT-T1E: T1E_1466Help
Entry
T1E_1466          CDS       T02181                                 

Gene name
adhP
Definition
(GenBank) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
ppx  Pseudomonas putida DOT-T1E
Pathway
ppx00010  Glycolysis / Gluconeogenesis
ppx00071  Fatty acid degradation
ppx00350  Tyrosine metabolism
ppx00625  Chloroalkane and chloroalkene degradation
ppx00626  Naphthalene degradation
ppx01100  Metabolic pathways
ppx01110  Biosynthesis of secondary metabolites
ppx01120  Microbial metabolism in diverse environments
ppx01130  Biosynthesis of antibiotics
ppx01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ppx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    T1E_1466 (adhP)
  Lipid metabolism
   00071 Fatty acid degradation
    T1E_1466 (adhP)
  Amino acid metabolism
   00350 Tyrosine metabolism
    T1E_1466 (adhP)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    T1E_1466 (adhP)
   00626 Naphthalene degradation
    T1E_1466 (adhP)
Enzymes [BR:ppx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     T1E_1466 (adhP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Methyltransf_25 AlaDh_PNT_C 2-Hacid_dh_C CoA_binding TrkA_N Methyltransf_31 Imm48
Motif
Other DBs
NCBI-ProteinID: AFO47321
UniProt: I7C2M0
Position
complement(1613414..1614424)
Genome map
AA seq 336 aa AA seqDB search
MKAAVVAPGRRVDVVEKTLRPLEHGEALLKMQCCGVCHTDLHVKNGDFGDKTGVVLGHEG
IGVVQEVGPGVTSLKPGDRASVAWFYQGCGHCEYCNSGNETLCRDVKNSGYTVDGGMAEA
CIVKADYSVKVPDGLDSAAASSITCAGVTTYKAVKISNVRPGQWVAIYGLGGLGNLALQY
AKNVFNAKVIAIDVNEEQLRFASEMGADLVVNPLNEDAAKVIQAKTGGAHAAVVTAVAKG
AFNSAVDALRAGGRLVAVGLPSESMDLNIPRLVLDGIEVVGSLVGTRQDLQEAFQFAAEG
KVVPKVTLRPIEDINQIFDEMLEGKIKGRMVIQFEG
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgctgtcgttgcaccaggccgtcgcgtggacgtggtagagaaaaccctgcgc
cctctcgaacacggcgaagcgctgctgaagatgcagtgctgcggtgtgtgccacaccgac
ctgcacgtgaaaaatggcgactttggtgacaagaccggtgtagtactgggccacgaaggt
attggcgtggttcaggaagttggcccgggcgtcacctcgctcaagccaggcgaccgtgcc
agcgttgcctggttctaccagggttgcggacattgcgaatattgcaacagcggcaacgag
accctgtgccgcgacgtgaagaattccggttacaccgtggacggcggcatggccgaggcc
tgcatcgtcaaggccgactactcggttaaagtgcccgacggcctcgactccgctgccgcc
agcagcatcacctgcgccggcgtcacgacctacaaggcagtgaagatctccaacgtccgc
cccggccaatgggtcgcgatctacggcctcggcggcctgggcaacctggccctgcaatat
gccaagaatgtgttcaacgccaaagtcatcgccatcgacgtcaacgaagagcaactgcgc
ttcgccagcgagatgggcgcggacctggtggtcaacccgctcaacgaagatgccgcgaag
gtcatccaggctaaaaccggcggtgcacatgctgccgtcgttactgccgttgccaaaggc
gcgttcaactcggctgtcgatgccttgcgcgctggcgggcgactggtggccgtcgggctt
ccgtcggagtccatggacctgaatattccccgcctggtgcttgatgggatcgaagtggtg
ggctcgctggtaggtacacgccaggacctgcaggaagccttccagtttgccgctgaaggc
aaagtggtgcccaaggtaacgctgcgaccgatcgaggatatcaaccagatctttgacgag
atgctggagggcaagatcaaaggccggatggtgatacagttcgaaggctga

DBGET integrated database retrieval system