KEGG   Pseudomonas putida DOT-T1E: T1E_1546Help
Entry
T1E_1546          CDS       T02181                                 

Gene name
ydgB
Definition
short chain dehydrogenase
Orthology
K13938  
dihydromonapterin reductase / dihydrofolate reductase [EC:1.5.1.- 1.5.1.3]
Organism
ppx  Pseudomonas putida DOT-T1E
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppx00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    T1E_1546 (ydgB)
   00670 One carbon pool by folate
    T1E_1546 (ydgB)
Enzymes [BR:ppx01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     T1E_1546 (ydgB)
    1.5.1.-  
     T1E_1546 (ydgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1710655..1711362)
Genome map
AA seq 235 aa AA seqDB search
MTTPNMNSPILVTGASQRVGLALALELAQAGHTVVSASRSILPQAAHPNIVQFQADLCQA
GDRQALIDHLHDRYDGLRAIIHNASLWLDDGLDNLETMFRLHVEAPYHLNLALGDLLAKV
EKADIIHICDETSSRGSKSHIGYAATKAALQNMVLSFAEKYAPKVRVNGILPGLLILKEG
GDEAYRQQTLKKALLEFEPGAGPLIETVKYLLASQYSTGSQVVINGGRHLKNRMT
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
ttgaccaccccgaacatgaacagccccattctcgttaccggagccagccagcgtgtcggg
ctggccctggccctcgaactggcacaggccggccatacggtggtcagtgccagccgcagc
atcctgccccaggcagcacaccccaacatcgtgcagtttcaggccgacctgtgccaggcg
ggcgaccgccaggcgctgatcgatcacctgcacgatcgttacgacggactgcgcgccatc
atccacaacgcctcgctatggctcgacgacggcctcgacaacctcgagaccatgttccgc
ctgcacgtcgaagcgccctaccacctcaacctggccctgggcgacctgctggccaaggtg
gaaaaggccgacatcattcacatctgcgacgaaacctcttcgcgcggcagtaaaagccac
atcggctacgccgccaccaaggccgcactgcagaacatggtgctgtcattcgccgaaaaa
tatgcgcccaaggtgcgtgtgaacggtatcctgcccgggctgctgatcctcaaggaaggg
ggtgacgaagcctaccgccagcaaaccctgaaaaaggccctgctggaattcgaacccggc
gccggcccgctgatcgagaccgtcaagtacctgctcgccagccagtacagcaccggcagc
caggtggtcatcaacggtggccgccacctgaagaaccgcatgacttga

DBGET integrated database retrieval system