KEGG   Pseudomonas putida DOT-T1E: T1E_1668Help
Entry
T1E_1668          CDS       T02181                                 

Gene name
cheB
Definition
Chemotaxis response regulator protein-glutamate
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
ppx  Pseudomonas putida DOT-T1E
Pathway
Two-component system
Bacterial chemotaxis
Module
CheA-CheYBV (chemotaxis) two-component regulatory system
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:ppx02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:ppx02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1830529..1831047)
Genome map
AA seq 172 aa AA seqDB search
MALQRVLTQLPANFPAPIVLIQHMPAAFTKAFAERLDKLCRISVKEAEDGDMLRPGLALL
APGGKQMMIDGRGTVKILPGDERLNYKPCVDITFGSAAKSYGDKVLSVVLTGMGADGREG
ARLLKQGGSTVWAQDEASCVIYGMPMAIVKANLADAVYSLDEIGKHLVEACV
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
gtggcgctgcagcgggtactgacccagctgccggccaatttcccggcgccgatcgtgttg
atccagcacatgccggcggcgttcaccaaagcgtttgccgaacgcctggacaagctgtgc
cgcatcagcgtcaaggaagccgaagacggcgacatgctgcgcccgggccttgccctgctg
gcccccggtggcaagcagatgatgatcgatggccgtggcacagtgaagatcctgcccggc
gacgagcgcctgaactacaagccgtgcgtggacatcaccttcggttcggcggccaagtcg
tacggtgacaaggtgttgtcggtggtgctcaccggcatgggcgccgatggccgcgagggc
gcgcgcctgctcaagcaggggggcagcacggtgtgggcccaggatgaagccagctgcgtg
atttatggcatgcccatggcgatcgtcaaggccaacctggcggatgccgtgtacagcctt
gacgaaatcggcaagcacctggtggaggcgtgcgtctga

DBGET integrated database retrieval system