KEGG   Pseudomonas putida DOT-T1E: T1E_1714Help
Entry
T1E_1714          CDS       T02181                                 

Gene name
chlI
Definition
magnesium chelatase
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
ppx  Pseudomonas putida DOT-T1E
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:ppx00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1875613..1876434
Genome map
AA seq 273 aa AA seqDB search
MSEPVQFPLAAVVGADDLKLALCLTAIDPRIGGVLIEGPRGMAKSTLARGLADLLGEGPF
VTLPLGASEERLVGTLDLDAALGQGKAQFSPGVLAQADGGVLYVDEVNLLPDTLVDLLLD
VAASGTNRIERDGISHRHSARFVLIGTMNPEEGELRPQLLDRFGLNVALEGLPEPEARQQ
IIRRRLAFDSDPQAFCAHWAQAQAQLRERCHAARQALADIALDDQALAWITERCYAAGVD
GLRADLVWLRAAIACFAGKPAPTTGQQQPHGLR
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaacccgtacaatttccgctggcggccgtggtcggtgcagacgacctcaagctg
gcgctgtgcctgaccgccatcgaccccaggatcggtggtgtgctgatcgaagggccgcgt
ggcatggccaagagcaccctggcccgtggcctggccgacctgcttggcgaaggcccgttc
gtcaccttgccattgggcgccagtgaagaacggttggtcggcaccctcgacctggatgcc
gcgctggggcagggcaaggcgcagttttccccgggcgtgctggcccaggccgacggcggt
gtgctgtatgtcgatgaagtcaacctgctgcccgacaccttggtcgatctgttgcttgac
gtggctgccagcggcacaaaccgtatcgaacgtgacggtatctcgcatcggcacagcgcc
cgcttcgtactgatcggcaccatgaacccggaagagggcgagctgcgcccgcagttgctc
gaccgtttcggcttgaacgtggcgctggagggcttgccggagcccgaggcccggcagcag
atcattcgccgccgtctggccttcgacagtgaccctcaggcgttctgcgcacactgggcc
caggcccaggcgcaactgcgcgagcgctgccacgcggcgcgccaggccttggccgacatt
gccctggatgaccaggcgcttgcctggattaccgagcgctgctacgccgccggcgtggac
ggcctgcgcgccgacctggtgtggctgcgcgctgcgattgcctgcttcgcgggtaaaccc
gctcctacaacaggtcagcagcaaccccacggcttgcgctaa

DBGET integrated database retrieval system