KEGG   Pseudomonas putida DOT-T1E: T1E_1988Help
Entry
T1E_1988          CDS       T02181                                 

Gene name
glk
Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
ppx  Pseudomonas putida DOT-T1E
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ppx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    T1E_1988 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    T1E_1988 (glk)
   00052 Galactose metabolism
    T1E_1988 (glk)
   00500 Starch and sucrose metabolism
    T1E_1988 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    T1E_1988 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    T1E_1988 (glk)
   00524 Butirosin and neomycin biosynthesis
    T1E_1988 (glk)
Enzymes [BR:ppx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     T1E_1988 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2176411..2177370
Genome map
AA seq 319 aa AA seqDB search
MKHLLVGDIGGTNARFALWRDNQLHEVNVFATADYTNPEQAIEAYLESQGIARGGLAAVC
LAVAGPVDGDEFRFTNNHWRLSRTAFCKTLQVERLLLINDFTAMALGMTRLREGEFREVC
PGQADPSRPALVIGPGTGLGVGSLLRLGEQHWKALPGEGGHVDLPVGNAREAAIHQQIHS
QIGHVSAEAVLSGGGLVRLYQAICALDGDTPRHKTPAHITDAALGGEPRALAVVEQFCRF
LGRVAGNNVLTLGARGGVYIVGGVIPRFAELFLRSGFAASFADKGCMSGYFTGVPVWLVT
AEFSGLEGAGVALQQALDH
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaagcacctgctggttggtgatattggcggcaccaatgcccgttttgcgttgtggcgt
gacaaccagctgcatgaagtaaatgttttcgccaccgcggactacaccaaccccgagcag
gccatcgaggcctacctggaaagccaaggcatcgcccgcggtggcctggcggcggtgtgc
ctggcggtggccggcccggtcgatggcgatgaatttcgcttcaccaacaaccactggcgc
ctgagccgcacggcattttgcaagaccttgcaggtcgagcgactgttgctgatcaatgat
ttcaccgctatggcgctgggcatgacgcgtctgcgcgaaggcgagttccgcgaggtgtgc
cccggccaggccgacccctcgaggccggcactggtgatcgggccaggtactggcctgggt
gtgggctcgctgctgcgtctgggcgaacagcactggaaggccctgccgggtgaaggcggg
catgttgacctgccggtaggcaatgctcgcgaagcggcaatccaccagcagatccacagt
cagatcggccatgtcagcgccgaggccgtgctcagtgggggggggctggtgcggctgtac
caggcgatctgtgcgctggacggcgacacgcccaggcacaagaccccggcgcatatcacc
gatgccgcactgggcggtgagccacgggcgctggcggtggtcgagcagttctgtcgtttc
cttgggcgagtggcgggtaacaatgtgctgacgctgggcgcgcgaggcggggtctatatt
gtgggcggcgtgattccgcgttttgccgagctgttcttgcgtagcgggtttgccgcgagt
tttgccgacaaggggtgtatgagtggctatttcaccggggtgccggtgtggctggtgacg
gcggaattttccggattggagggggcaggggtagcgttgcagcaggcgttggatcactga

DBGET integrated database retrieval system