KEGG   Pseudomonas putida DOT-T1E: T1E_2108Help
Entry
T1E_2108          CDS       T02181                                 

Gene name
btuE
Definition
peroxiredoxin
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
ppx  Pseudomonas putida DOT-T1E
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:ppx00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    T1E_2108 (btuE)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    T1E_2108 (btuE)
Enzymes [BR:ppx01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     T1E_2108 (btuE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2303852..2304334)
Genome map
AA seq 160 aa AA seqDB search
MSAFHDLKLEALNGGELPLAPFKGQVVLVVNVASKCGLTPQYKALENLYQIYKDKGFNVL
GLPCNQFAGQEPGSEKEIQDFCSLNYGVSFPLGGKLEVNGPQRHSLYRLLAGEGAEFPGD
ITWNFEKFLVGKDGRVLARFSPRTAPDDPAVVQAIEKALV
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcatttcacgacctgaaactggaagcgctgaacggcggagagctgcccctcgca
cccttcaagggccaagtggtgctggtggtcaacgtcgcctccaaatgtggcctgacgcca
caatacaaggccctggaaaacctctaccagatctacaaggacaagggcttcaatgtgctt
ggcctgccgtgcaaccagtttgccgggcaggagccgggtagcgaaaaggaaatccaggac
ttctgcagcctcaactacggggtcagcttcccgctggggggcaagctggaggtcaatggg
ccgcagcgccattcgttgtaccgcctgctggcaggcgagggggccgagttccccggtgac
attacctggaatttcgagaagtttctggtaggcaaggatggccgggtgctggcgcgtttc
tcaccccgcacggcgccggatgacccagcagtggtgcaggccattgaaaaagcactggtc
tga

DBGET integrated database retrieval system