KEGG   Pseudomonas putida DOT-T1E: T1E_2197Help
Entry
T1E_2197          CDS       T02181                                 

Gene name
glcB
Definition
(GenBank) Malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
ppx  Pseudomonas putida DOT-T1E
Pathway
ppx00620  Pyruvate metabolism
ppx00630  Glyoxylate and dicarboxylate metabolism
ppx01100  Metabolic pathways
ppx01110  Biosynthesis of secondary metabolites
ppx01120  Microbial metabolism in diverse environments
ppx01200  Carbon metabolism
Module
ppx_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ppx00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    T1E_2197 (glcB)
   00630 Glyoxylate and dicarboxylate metabolism
    T1E_2197 (glcB)
Enzymes [BR:ppx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     T1E_2197 (glcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase DUF3355
Motif
Other DBs
NCBI-ProteinID: AFO48045
UniProt: I7AZA9
Position
2404920..2407097
Genome map
AA seq 725 aa AA seqDB search
MTGYVQVGGLQVAKVLYDFVNNEAIPGTGIVAEQFWAGAEKIINDLAPKNKALLAKRDEL
QAKIDAWHQARKGQAHDAAAYKAFLQEIGYLLPQADDFQATTQNVDEEIAHMAGPQLVVP
VMNARFALNAANARWGSLYDALYGTDAISDEGGAEKGQGYNKVRGDKVIAFARAFLDEAA
PLAAGSHVDSTGYRIEGGKLVVALKGGSNSGLRDDAQLIGFHGDAAAPTAVLLKHNGLHF
EIQVDASTPVGSTDAAGVKDILMESALTTIMDCEDSVAAVDADDKVIVYRNWLGLMKGDL
AESVSKGGKTFTRTMNPDREYAAPNGGSVTLHGRSLLFVRNVGHLMTNPAILDAQGNEIP
EGIQDGLFTNLIALHNLNGNTSRKNTRSGSVYIVKPKMHGPEEVAFAAEIFSQVEDLLGM
PRNTVKVGIMDEERRTTVNLKSCIKAAAERVAFINTGFLDRTGDEIHTSMEAGAVVRKGA
MKNEKWIGAYENNNVDVGLATGLQGRAQIGKGMWAMPDLMAAMLEQKIAHPLAGANTAWV
PSPTAATLHALHYHKVDVQARQRELASRTPASVDDILAIPLAADTNWSAEEIRNELDNNA
QGILGYVVRWIDQGVGCSKVPDINNVGLMEDRATLRISAQLLANWLRHGVVSQEQVLESL
KRMAVVVDQQNAGDALYRPMAPNFDDNVAFQAAVELVVEGGKQPNGYTEPVLHRRRREFK
ARNGL
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgactggatacgttcaagtcggtggccttcaggtcgccaaggtcctgtacgacttcgtg
aacaacgaagccatccccgggaccggcatcgtcgccgagcagttctgggcgggtgcagag
aagatcatcaatgacctcgctccaaagaacaaagccctgctcgccaagcgcgacgagctg
caagccaagatcgacgcctggcaccaggcacgcaaaggccaggcccacgacgccgcagcc
tacaaagcattcctccaggaaatcggctacctgctgccacaagccgacgatttccaggcc
accacccagaacgtggacgaagaaatcgcccacatggccggcccacaactggtcgtgccg
gtgatgaacgcccgcttcgccctgaacgccgccaacgctcgctggggttcgctgtacgac
gccctgtacggcaccgacgccatcagcgatgaaggcggcgccgaaaaaggccagggttac
aacaaggtacgcggcgacaaggtcatcgccttcgcccgcgccttcctcgacgaagccgcg
ccactggccgccggctcgcacgttgactccacgggctaccgcatcgaaggcggcaagctg
gtcgttgccttgaaaggcggcagcaacagcggcctgcgcgacgatgcgcaactgatcggc
ttccacggcgacgccgccgcgccgactgccgtgctgctcaagcacaacggcctgcacttc
gaaatccaggtcgatgccagcacccccgtcggcagcaccgacgccgctggcgtcaaagac
atcctgatggagtcggcactgaccaccatcatggactgcgaagactcggttgcagccgta
gacgctgacgacaaagtcatcgtctaccgcaactggctgggcttgatgaaaggcgacctg
gccgaaagcgtgagcaagggtggcaaaaccttcacccgcaccatgaacccggaccgcgag
tacgcggcgcctaacggcggcagcgtgaccctgcacggtcgttcgttgctgttcgtgcgc
aacgttggccacctgatgaccaacccggcgatcctcgatgcccaaggcaacgaaatcccc
gaaggtatccaggacgggctgttcaccaacctgatcgccctgcacaacctcaacggcaac
accagccgcaagaatacccgcagcggcagcgtgtacatcgtcaagccgaagatgcacggc
cctgaggaagtggccttcgccgctgagatcttcagccaggtcgaagacctgctgggcatg
ccgcgcaacaccgtcaaggtcggcatcatggacgaggaacgccgtaccacggtcaacctc
aaatcctgcatcaaggcagccgccgagcgcgtggcgttcatcaacaccggcttccttgac
cgcactggcgatgaaatccacacctcgatggaagccggcgccgtggtgcgcaaaggtgcc
atgaagaacgagaagtggatcggcgcctacgaaaacaacaacgtcgacgttggcctggcc
accggcctgcaaggccgtgcgcagatcggcaaaggcatgtgggccatgcctgacctgatg
gccgccatgctcgagcagaagatcgcccacccgctggccggtgccaacaccgcttgggta
ccgtcgccaactgccgccaccctgcacgccctgcactaccacaaggtggacgtacaggcg
cgccagcgtgaactggcttcacgtaccccggcgtcggtggacgacattctggccattccg
ctggctgccgacaccaactggtcggccgaagagatccgcaacgagctggacaacaacgcc
cagggcattctcggctacgtggtgcgttggatcgaccagggcgtgggttgctcgaaggtg
ccggacatcaacaacgtcggcctgatggaagaccgtgccaccctgcgcatctctgcccag
ctgctggccaactggctgcgccacggcgtggtcagccaggagcaggtgctggaaagcctc
aagcgcatggccgtggtggtcgatcagcagaacgctggcgacgccctgtaccgcccgatg
gcgccgaacttcgacgacaacgtggcgttccaggcggctgtggaactggtggtggaaggt
ggcaagcaaccgaacggttataccgaaccggtactgcaccgccgtcgccgcgagttcaag
gcgcgtaacgggttgtaa

DBGET integrated database retrieval system