KEGG   Pseudomonas putida DOT-T1E: T1E_2429Help
Entry
T1E_2429          CDS       T02181                                 

Definition
3-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
ppx  Pseudomonas putida DOT-T1E
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:ppx00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:ppx00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2662650..2663420)
Genome map
AA seq 256 aa AA seqDB search
MTLEGKTALVTGSTSGIGLGIAQVLARAGANIVLNGFGDPGPAMAEIARHGVKAVHHPAD
LSEVIQIEALFNLAEREFGGVDILVNNAGIQHVAPVEQFPPESWDKIIALNLSAVFHGTR
LALPGMRTRNWGRIINIASVHGLVGSIGKAAYVAAKHGVIGLTKVVGLETATSHVTCNAI
CPGWVLTPLVQKQIDDRAAKGGDRLQAQHDLLAEKQPSLAFVTPEHLGELVLFLCSEAGS
QVRGAAWNVDGGWLAQ
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgacccttgaaggcaaaactgcactcgtcaccggttccaccagcggcattggcctgggc
atcgcccaggtattggcccgggctggcgccaacatcgtgctcaacggctttggtgacccg
ggccccgccatggcggaaatcgcccggcacggggtgaaggctgtgcatcacccggccgac
ctgtcggaggtgatccagatcgaggccttgttcaacctggccgaacgtgaattcggcggc
gtcgacatcctggtcaacaacgccggtatccagcatgtggcaccggttgagcagttcccg
ccagaaagctgggacaagatcatcgccctgaacctgtcggccgtattccatggcacgcgc
ctggcgctgccgggcatgcgcacgcgcaactgggggcgcatcatcaatatcgcttcggtg
catggcctggtcggctcgattggcaaggcagcctacgtggcagccaagcatggtgtaatc
ggcctgaccaaggtggtcggcctggaaaccgccaccagtcatgtcacctgcaatgccata
tgcccgggctgggtgctgacaccgctggtgcaaaagcagatcgacgatcgtgcggccaag
ggtggcgatcggctgcaagcgcagcacgatctgctggcagaaaagcaaccgtcgctggcc
ttcgtcacccccgaacacctcggtgagctggtactcttcctgtgcagcgaggccggtagc
caggttcgcggcgccgcctggaacgtcgacggtggctggttggcccagtga

DBGET integrated database retrieval system