KEGG   Pseudomonas putida DOT-T1E: T1E_2498Help
Entry
T1E_2498          CDS       T02181                                 

Gene name
cysQ
Definition
3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
ppx  Pseudomonas putida DOT-T1E
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:ppx00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2739839..2740657
Genome map
AA seq 272 aa AA seqDB search
MNDLQLMHEVVKLALTAGEAILPFWRADVAVTNKADDSPVTAADLAAHRVIADGLLALAP
QIPVLSEEDCNIALAERQSWSRWWLVDPLDGTKEFIAGSEEFTVNIALIENGEVVFGVVS
MPTNGRCYFGGRGMGAWRADAGEAAQLIQVRNAPAQGERFTVVASRRHSSPEQEALLAGL
GAAVGELELANIGSSLKFCLLAEGSADCYPRLAPTSQWDTAAAQGVVEGAGGEVIGLDGL
PFRYPPRESLLNPHFLALPANAAWRQAFLNLI
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacctgcaactgatgcacgaagtggtcaagctggcgctgacggcaggcgaggcg
atcctgccattctggcgcgccgatgtcgcggtaaccaacaaggccgacgattcgccggtt
accgccgccgacctggccgcgcaccgggtaattgccgatggtctgctggcgctggcgccg
cagattccggtgctgtccgaagaggactgcaatattgcgctggccgagcggcaaagctgg
agccgctggtggctggtcgatccgctggatggcaccaaggaattcattgccggcagtgaa
gagttcacggtcaacatcgccctgatcgagaacggcgaggtggtgtttggcgtggtgtcg
atgcccaccaatgggcgctgctattttggtgggcgcggcatgggggcctggcgtgcagat
gccggtgaggcagcccagctgatccaagtacgcaacgcacccgcgcagggcgagcgtttt
accgtggtggccagccgtcggcattccagcccggagcaggaagcgctgttggccggcctt
ggggctgcggtgggcgaactggagctggccaatatcggcagctcgttgaagttctgcctg
ctggccgagggcagcgccgattgttatccgcgcctggcgccgacttcgcagtgggacact
gctgcggcgcagggtgtggtggagggggccggtggcgaagtgatcgggctggatggcttg
ccgttccggtatccgccacgcgagtcgctgctcaatccgcatttcctggcattgcctgcc
aatgctgcatggcgccaggccttcctgaacctcatctaa

DBGET integrated database retrieval system