KEGG   Pseudomonas putida DOT-T1E: T1E_2571Help
Entry
T1E_2571          CDS       T02181                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
ppx  Pseudomonas putida DOT-T1E
Pathway
ppx00900  Terpenoid backbone biosynthesis
ppx01100  Metabolic pathways
ppx01110  Biosynthesis of secondary metabolites
ppx01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ppx00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    T1E_2571
Enzymes [BR:ppx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     T1E_2571
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C Semialdhyde_dh
Motif
Other DBs
NCBI-ProteinID: AFO48416
UniProt: I7C5M2
Position
2821103..2822293
Genome map
AA seq 396 aa AA seqDB search
MSRPQRITVLGATGSIGLSTLDVIARHPDRYQAFALTGYSRIDELLALCVRHRPAFAVVP
STEAAVRLRAGLAAAGCTTEVLEGEAGLCQVASAAEVDAVMAAIVGAAGLRPTLAAVEAG
KKVLLANKEALVMSGALFMEAVRQKGAVLLPIDSEHNAIFQCMPGDYTRGLSAVGVRRIL
LTASGGPFRETPVEALLDVTPEQACAHPNWSMGRKISVDSASMMNKGLELIEACWLFDAV
PSKVEVVVHPQSVIHSLVDYVDGSVLAQLGNPDMRTPIASALAWPERIDSGVAPLDLFAI
ARLDFQAPDEQRFPCLRLARQAAEAGNSAPAVLNAANEVAVQAFLERRIRFPEIAGMIEQ
VLDQEPVVPLPSLDAVFAADQRARELSREWLRRHGR
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
gtgagtcgcccgcagcgtattaccgtactcggggccaccggctccattggcctgagcacg
ctggatgtgattgcgcgtcatcctgaccgttatcaagcgtttgccctcactggctattcg
cgcatcgacgagctgttggccttatgtgtgcgtcatcgcccggcattcgctgtggtgccg
agcactgaggcggcggtgaggttgcgtgcgggtctggctgcggccggctgcaccaccgag
gtgctggaaggtgaggccgggctttgtcaggtggcgtcggccgctgaagtggatgcagtg
atggcagccattgtcggtgctgccggcctgcggcccacgctggcagcggtcgaggccggc
aagaaggtgttgctggccaacaaggaagcactggtgatgtcgggcgcactgttcatggag
gcggtgcggcaaaaaggggccgtgctgctgccgatcgacagcgaacacaacgctatcttc
cagtgcatgccaggcgactacacccgtggtctgagtgccgtcggtgtgcgccggatcctg
cttaccgcgtccggcgggccgttccgcgaaacgccggtcgaggcgctgctggacgtgacc
ccggagcaagcctgtgcgcaccctaactggtccatggggcgcaagatttccgtggattcg
gccagcatgatgaacaaaggcctcgagttgatcgaagcctgctggttgttcgatgccgtg
ccatccaaggttgaggtagtggtgcacccgcagagcgtaatccactcgctggtcgactac
gtggacggttcggtactcgcgcagttgggcaacccggacatgcgtacgccgatcgccagc
gcgttggcctggccggaacggatcgattccggggttgcccctctggacctgttcgccatc
gcccgtctggatttccaggcgcccgacgaacaacgcttcccttgcctgcgccttgcgcgg
caggctgccgaggccggcaacagcgcgcctgccgtgctcaatgcggccaacgaagtcgcg
gtccaggcatttcttgaacggcgcatccgcttcccggagatcgcgggtatgatcgaacag
gtactcgaccaggaacccgtcgtaccgctgccgtcgctggatgcggtatttgccgccgat
cagcgtgcccgggagctttcccgtgagtggctgaggcgtcacggccgctga

DBGET integrated database retrieval system