KEGG   Pseudomonas putida DOT-T1E: T1E_2847Help
Entry
T1E_2847          CDS       T02181                                 

Gene name
dsbC
Definition
hypothetical protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
ppx  Pseudomonas putida DOT-T1E
Brite
Enzymes [BR:ppx01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     T1E_2847 (dsbC)
Secretion system [BR:ppx02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   T1E_2847 (dsbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3111210..3111953
Genome map
AA seq 247 aa AA seqDB search
MRVTQFFAAAALALASTFAVAAATDSNAGAEQAIRKSLQNLELEVPVESVASSPLNGLYE
VKLQGGRVLYASADGQFVMQGYLFQIQDGKPVNLTEKTERQGIAKLINGIPAAEMVVYPA
KGETKSHITVFTDTTCPYCHKLHAEVPELNRRGIEVRYVAFPRQGLGSAGDQQLQAVWCS
SDRRGAMDKMVEGEEIKAAKCTNPVSKQFQLGQSIGVNGTPAIVLESGQVIPGYQPAPQV
AKLALAK
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtgacccagtttttcgccgccgccgcgttggcgctggccagtacctttgccgtt
gccgcggcaaccgatagcaacgccggtgccgagcaggccatccgtaaatcgttgcagaac
ctcgagttggaagtgcccgtggaaagcgtggccagcagcccgctcaacggcctgtatgaa
gtcaagctgcagggcggccgcgtgctgtacgccagcgctgacggccagttcgtgatgcag
ggctacctgttccagatccaggacggcaagccggtcaacctcaccgaaaaaaccgaacgc
caaggtatcgccaagctcatcaacggcattccagccgccgagatggtggtttatcctgcc
aaaggcgagaccaagtcgcacatcaccgtgttcaccgacactacctgcccgtactgccac
aaactgcacgccgaagtgcctgagttgaaccgtcgcggtatcgaagtgcgctatgtcgcc
ttcccgcgtcagggcctcggttcggcgggtgaccagcagttgcaggcggtgtggtgctcc
agcgaccgccgtggggcgatggacaaaatggtcgaaggtgaagaaatcaaggccgccaag
tgcaccaacccggtcagcaagcagttccagctgggtcagtcgatcggtgtcaacggcacg
ccggccattgttcttgaaagcggccaggtcattccgggctaccagccggcaccgcaggtc
gccaagctggcacttgccaagtaa

DBGET integrated database retrieval system