KEGG   Pseudomonas putida DOT-T1E: T1E_3027Help
Entry
T1E_3027          CDS       T02181                                 

Definition
(GenBank) phosphomannomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
ppx  Pseudomonas putida DOT-T1E
Pathway
ppx00010  Glycolysis / Gluconeogenesis
ppx00030  Pentose phosphate pathway
ppx00051  Fructose and mannose metabolism
ppx00052  Galactose metabolism
ppx00230  Purine metabolism
ppx00500  Starch and sucrose metabolism
ppx00520  Amino sugar and nucleotide sugar metabolism
ppx00521  Streptomycin biosynthesis
ppx01100  Metabolic pathways
ppx01110  Biosynthesis of secondary metabolites
ppx01120  Microbial metabolism in diverse environments
ppx01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ppx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    T1E_3027
   00030 Pentose phosphate pathway
    T1E_3027
   00051 Fructose and mannose metabolism
    T1E_3027
   00052 Galactose metabolism
    T1E_3027
   00500 Starch and sucrose metabolism
    T1E_3027
   00520 Amino sugar and nucleotide sugar metabolism
    T1E_3027
  Nucleotide metabolism
   00230 Purine metabolism
    T1E_3027
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    T1E_3027
Enzymes [BR:ppx01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     T1E_3027
    5.4.2.8  phosphomannomutase
     T1E_3027
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_III PGM_PMM_II PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: AFO48864
UniProt: I7CAJ7
Position
3310204..3311565
Genome map
AA seq 453 aa AA seqDB search
MYPPIQTRCFKAYDIRGQVPADLNEDVAYRIGRALVAELGGRSYVVGRDMRLESPTLSQA
LMRGLTEGGADVIDIGLCGTEEVYFATSHYQAGGGIMVTASHNPKGYNGMKLVREHSRPI
SGDTGLKDIRQRVESGDLGTAAPAAGSVRLASDKSAYIDHLLTYVDLATLKPLKVLADPG
NGAVGPVLELLKARLPLKLTVINGEPDGNFPNGIPNPLLPENRDLTRQAVLDTGADMGIA
FDGDFDRCFFFDNQGRFIEGYYVVGLLAEMLLAKHPGSKIIHDPRLTWNTIKQVEEAGGM
AIQSKTGHAFIKERMRAEDAVYGGEMSAHHYFRDFAYCDSGNIPWLLVAQLMSVTGKSLG
QLVDERIAAFPCSGEINYEVEDVKDTIEKILAHYLPQNPSVDRTDGISVEFADWRFSLRG
SNTEPLLRLNVESRGDQALVERQVAQIAGLIRG
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgtacccacccattcagacccgctgcttcaaagcctatgacattcgcggccaagtgccg
gctgatctcaatgaggatgttgcctatcgtattggtcgtgccttggtggctgagctgggt
gggcgcagctacgtggtaggtcgtgacatgcgcttggaaagcccgactctttcccaagca
ttgatgaggggccttactgaaggcggcgccgacgttatagatattggcctttgtggcacc
gaggaagtgtacttcgctaccagccactaccaggccggcggtggcatcatggtaaccgcc
agccataatcccaaaggctataacggcatgaaactggtgcgcgagcattcgcgacctatc
agtggtgacacgggcctcaaggatattcgccagcgggtggaatccggtgatttggggacc
gcagccccggccgcaggcagtgttcgcctggcgtccgacaaaagcgcttacatcgaccac
ctgctgacctatgtggacctggctaccctcaaaccattgaaagtgctggcggatccgggt
aatggtgctgtcggcccggtgctggagctgttgaaggcgcgcctgccactgaagctcact
gttatcaatggggaaccagatggcaacttccctaatggcatccccaacccgctgctaccg
gaaaaccgtgaccttacacgccaagctgtcctggataccggtgcagacatgggtattgcc
ttcgatggtgatttcgatcgctgcttcttcttcgacaatcaggggcgtttcatcgagggc
tactatgtagttggcctgttggctgaaatgctgctggccaagcacccaggcagcaaaatc
attcacgacccgcgcctgacctggaacaccatcaaacaggttgaagaagcagggggaatg
gcaatccagagcaagaccggccatgccttcataaaagagcgtatgcgcgccgaagatgcg
gtatatggcggcgaaatgagcgcccaccattacttccgtgactttgcctactgcgacagc
ggtaacatcccttggctcctggtcgctcagttgatgagcgtaacgggcaaaagcctgggg
caactggtggacgaacgtattgcagcgttcccgtgcagtggcgaaatcaactacgaagtg
gaggatgttaaagacactatcgagaagattcttgctcactacttgccgcaaaaccccagc
gtcgaccgcaccgacggtatcagcgtagagttcgctgactggcgttttagcctgcgtggg
tccaacaccgagccattgctgcgcctcaatgtcgagagccgaggcgatcaggctttggtt
gagcgccaggttgcacaaatcgccggcttaatcagaggttaa

DBGET integrated database retrieval system