KEGG   Pseudomonas putida DOT-T1E: T1E_3286Help
Entry
T1E_3286          CDS       T02181                                 

Gene name
ech1
Definition
(RefSeq) enoyl-CoA hydratase
  KO
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
ppx  Pseudomonas putida DOT-T1E
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ppx00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    T1E_3286 (ech1)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    T1E_3286 (ech1)
   00650 Butanoate metabolism
    T1E_3286 (ech1)
  Lipid metabolism
   00071 Fatty acid degradation
    T1E_3286 (ech1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    T1E_3286 (ech1)
   00310 Lysine degradation
    T1E_3286 (ech1)
   00360 Phenylalanine metabolism
    T1E_3286 (ech1)
   00380 Tryptophan metabolism
    T1E_3286 (ech1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    T1E_3286 (ech1)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    T1E_3286 (ech1)
   00281 Geraniol degradation
    T1E_3286 (ech1)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    T1E_3286 (ech1)
   00627 Aminobenzoate degradation
    T1E_3286 (ech1)
   00930 Caprolactam degradation
    T1E_3286 (ech1)
Enzymes [BR:ppx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     T1E_3286 (ech1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(3622000..3622812)
Genome map
AA seq 270 aa AA seqDB search
MTEYSALKVELTDSVAHVQINRPEKVNAMNAAFWEEIVDIFQWIDDTDAVRAVVISGAGK
HFSAGIDLMMLASLAGQMGKDVGRNARFLRKTIQRLQASFTAVDTCRKPVLAAVQGYCIG
GAIDLISACDMRYCSSDAQFSIKEIDMGMAADVGTLQRLPRIIGDGIMRELAFTGRNVEA
DEALRIGLVNRVYDDQGALMDGVFAIAREIAAKSPIAVAGTKEMLSYMRDHRIDDGLDYI
ATWNAAMLQSEDLRVAVAAHMSKQKPTFAD
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgagtacagtgcattaaaggtcgaactgaccgacagcgtcgcccatgttcagatc
aatcgcccagagaaggtcaacgcgatgaatgcggccttctgggaggaaatcgtcgacatc
ttccagtggatcgatgacaccgatgccgtgcgcgcggtggtgatcagcggcgctggcaag
cacttttccgccggtatcgacctgatgatgctggcctcgctggctgggcagatgggcaag
gacgtgggccgcaatgcacgcttcctgcgcaagaccatccagcggctgcaggcctcgttc
actgctgtggacacgtgccgcaaacccgtactggcggccgtgcaaggctactgcatcggc
ggcgccatcgacctcatctcggcgtgcgacatgcgctactgcagcagtgacgcgcagttc
tcgatcaaggaaatcgacatgggtatggcggccgatgtcggcacattgcaacgtttgcca
cgcatcattggcgacggcatcatgcgggagctggcgtttaccgggcgcaatgtcgaggcc
gacgaggcgctgcgcatcggcctggtcaaccgagtctatgatgatcagggcgcactgatg
gacggcgtctttgccatcgcccgcgagattgccgcaaaatcgccgatcgctgtggccggc
accaaggaaatgctcagctacatgcgtgaccatcgcatcgacgatggcctggactacatt
gccacctggaacgccgcaatgctgcagtccgaagacctgcgcgtggcggtggcggcgcac
atgagcaaacagaaaccgacgttcgccgactga

DBGET integrated database retrieval system