KEGG   Pseudomonas putida DOT-T1E: T1E_3309Help
Entry
T1E_3309          CDS       T02181                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
ppx  Pseudomonas putida DOT-T1E
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppx00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    T1E_3309 (malQ)
Enzymes [BR:ppx01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     T1E_3309 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3649798..3651867
Genome map
AA seq 689 aa AA seqDB search
MSETALHRLASSVGLSRDWIDANARPQRVSDDVLRNVLEGLGHPAGDEAAVAASLRAVET
AEDSEHLPPLLTADLGQPLALSRYFSAASVAHCTLEDHTSVTLSLDDQARLPGELPIGYH
QVEIDSRRFTVAVAPTRCHSLEDKVQQPPPRYWGLAVQLYSLRRPGDGGFGDCLALEQLA
RSAAERGADALAISPIHALSAIDQEHYSPYSPSSRLLLNTLYTSPAALLGEREVRMAIEA
CGLEQQLEELEQRPLVDWPRAASARLRLLEALYQGFSQGDHPLRTDFDSFREAGGQTLEH
HCRFEVLQAQAVEHGLGADWRNWPKAWHDPYHPEVEALANAYPAKVEFHAFCQWLTERGL
QRAHEAARSNGMAVGLIADLAVGADGAGSQAWSRQDELLAGLSVGAPPDILNHVGQDWGI
CAFSPEGLKRNGYRAFIEMLRANLAHAGGLRIDHVMGLRRLWLIPQGAKPSEGAYLDYPL
DDLLRLLALESVRHQAIILGEDLGTVPDSLREKLAEKAVLGMRVLPFEQTQPGQFKPILD
WPDNALATTGTHDLAPLAGWLANRDIDWRHRLQLIDAAAELHWRHERQKERDGLRRILEA
NYGELKDNDALIDAAIRFVGHTRAPLVLVPLEDLLGCDEQPNLPGTTNGHPNWRRRFALP
VRELLDDEDAARRLELLAQAREQAWERDR
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaaccgccctgcaccgtctggcatccagcgtcgggctgagccgcgactggatc
gacgccaatgccaggccccagcgtgtcagcgacgacgtgctgcgcaacgtcctcgaaggc
cttggccacccggccggcgatgaagcggccgttgccgccagcctgcgtgcggtggaaacc
gccgaagacagcgaacacctgccgcccttgctgaccgccgacctaggccagccgctagcg
ctgtcgcgctacttcagtgccgccagcgtggcccactgcaccctggaagatcacacctcg
gtcaccctcagcctcgatgaccaggcgcgcctgcccggcgagctgcccatcggctatcac
caggtggaaatcgacagccgccgcttcaccgtggcggtggcgccaacacgctgccacagc
ctggaagacaaggtgcaacagccgccaccacgctactggggcctggcagtgcagctgtac
agcctgcgccgccccggcgatggtggcttcggcgactgcctggcgctggagcagttggcc
cgctcggccgccgagcgcggcgccgatgccttggctatcagcccgattcacgccctgtcg
gccatcgaccaggaacactacagcccctactcaccttccagtcgcctgctgctcaacacc
ctgtacaccagccccgcagccctgctgggtgaacgggaggtgcgcatggccatcgaagcc
tgcgggctggagcaacaactcgaagagctggagcagcgccctctggtcgactggccacgc
gccgccagcgctcggctgcgcttgcttgaagcgctttaccaaggcttcagccaaggcgac
cacccgctacgcactgattttgacagcttccgcgaagccggcggccagaccctggagcac
cactgccgcttcgaggtgctgcaggcccaggcggtggagcacggcctcggggccgactgg
cgcaactggcccaaagcctggcacgacccctaccacccggaagtggaggctttagccaat
gcctacccggccaaggtcgagttccacgccttctgccagtggctgaccgaacgtggcctg
caacgtgcccacgaagcggcccgcagcaacggcatggccgtgggcctgatcgccgacctg
gcggtgggcgccgacggtgccggcagccaggcctggagccgccaggacgaactgctggcc
ggcctgagcgtgggtgcgccgcccgacatcctcaaccacgtcgggcaagactggggcatt
tgcgccttctcgcccgagggcctcaagcgtaatggctatcgcgccttcatcgagatgctg
cgggccaacctcgcccacgctggcggcctgcgcatcgaccatgtgatgggcctgcgccgg
ctatggctgatcccgcagggggccaaacccagcgaaggcgcctacctcgattacccgcta
gacgacctgttgcgcctgctggcgctggagtcggtgcgtcaccaggcgatcatcctcggc
gaagacctgggcaccgtgcccgacagcctgcgcgaaaagctggccgagaaagcggtgctg
ggcatgcgcgtgctgccgttcgagcagacccagccgggccagttcaagcccattctcgac
tggccggacaatgccctggccacaaccggtacccacgacctggcgccactggccggctgg
ctggcaaaccgcgacatcgactggagacaccgcttgcaactgattgatgctgctgccgaa
ttgcactggcgacacgagcgtcagaaagaacgcgacggcctgcgccgcatcctggaggcc
aactacggcgaactgaaggacaacgacgcgctgatcgatgcggccatccgcttcgttggc
catacccgtgcgccgctggtgctggtaccgctggaagacctgctgggctgcgacgagcaa
cccaacctgccgggcaccaccaatggccatcccaactggcggcggcgctttgcccttcca
gtacgcgaactgctcgacgacgaggatgccgcacggcgcctggagctgctggcccaggcc
cgcgaacaggcgtgggagcgcgaccgatga

DBGET integrated database retrieval system