KEGG   Pseudomonas putida DOT-T1E: T1E_3428Help
Entry
T1E_3428          CDS       T02181                                 

Gene name
rbsK
Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
ppx  Pseudomonas putida DOT-T1E
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:ppx00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    T1E_3428 (rbsK)
Enzymes [BR:ppx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     T1E_3428 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3790747..3791655)
Genome map
AA seq 302 aa AA seqDB search
MNAKVVVVGSLNMDLVVRAQRLPRAGETLPGDSFFTVPGGKGANQAVAVARLGGSVAMIG
NVGDDDYGRQLHRALYVEGIDCQGVSTCPGTSSGVALITVDAASQNCIVIIPGANGLLTP
QSVLRFDALLQAAEVVICQLEVPTDTVACTLARARELGKQVILNPAPATGPLPADWFAHI
DYLTPNESEAEALTGVAVTDQDSARRAGERLLQLGAGKVIITLGAQGALLVTAQGHQHYP
APRVQPLDTTAAGDTFIGGFAAALVRGLKEGEAIAFGQRAAALSVTRAGAQPSIPYLAEL
TP
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgaatgccaaggttgtggtggtcggcagcctcaacatggacctggtggtccgcgcccag
cgcctgccacgggccggcgaaacactccccggcgatagctttttcacggtgccgggcggc
aagggtgccaaccaggcggtggcggtagcgcggctggggggcagcgtggcgatgatcggc
aatgtgggggatgatgattacggtcggcaactgcaccgggccttgtatgtcgagggtatc
gactgtcagggtgtcagcacctgcccgggcacgtccagcggtgtggcgctgatcacggtg
gatgctgccagccagaactgtattgtcatcattcccggcgccaacggcctgctgacgccg
cagtcggtgctgcgtttcgatgcactgctgcaggccgccgaggtggtcatctgccagctg
gaagtgcccactgacactgtggcgtgcacactggccagggcgcgtgagctgggcaagcag
gtcatcctgaatccagcacccgctaccggccccttgccagcggactggtttgcgcatatc
gattaccttacccctaacgaaagcgaggccgaagccttgaccggtgtggcggtgaccgac
caggacagtgcccggcgcgcaggtgagcgcttgctgcagctgggggcaggcaaagtgatc
atcaccttgggtgcgcaaggtgccttgctggttactgcccaaggccatcagcactatccg
gcgccgcgcgtgcaaccgctggacaccaccgctgccggcgataccttcattggtggcttt
gctgccgccctggtgcgtgggctgaaggagggcgaggcgatcgcctttggccagcgtgcc
gcggcattgtcggttacccgtgccggtgcccaaccgtcgattccctacctggcggagctg
acgccatga

DBGET integrated database retrieval system