KEGG   Pseudomonas putida DOT-T1E: T1E_3828Help
Entry
T1E_3828          CDS       T02181                                 

Gene name
ccp
Definition
cytochrome-c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
ppx  Pseudomonas putida DOT-T1E
Brite
Enzymes [BR:ppx01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     T1E_3828 (ccp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4201448..4202446
Genome map
AA seq 332 aa AA seqDB search
MSARTTCRYRSALHLQRLRRCLGLWVLLVLSGGSGAEPLDEPLKPLPPIPTLAPGRVELG
RQLFNDPRLSRNGTRSCASCHRLDKYGADDRAFSMGADGLPLTLNTPTVLNASLNFRQFW
NGRVESLEEQGEAVITSAHEMGGDWRVIEQRIAADVHYRQGFKDAYPDAVTKDNILSALA
DYQRTLLTPGARFDRYLQGDTEALTLEEKYGYQRFKDYGCIACHQGVNIGGNMFQKFGVF
GDYIADRGHPTEADQGRFNVTGEEADRGVFKVPSLRNVAMTAPYFHDGSAPTLERAIDVM
FQYQLGRIPSDEDRRLIMLFLKTLTAEKAGQP
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcgcgcacaacctgtcgttatcgttccgctcttcacctgcagcgcttgcgccgt
tgtctgggcctgtgggtgctgctcgttctgagcggaggcagcggggcggagccgctggac
gagccgctcaagccgctgcctccgatacccactctggcacctgggcgtgtcgagttgggc
cgccagttgttcaacgatccgcggttgtcgcgcaacggcacacggtcctgcgccagctgt
caccgtctggacaagtacggggccgatgaccgggcgttttccatgggggcagatggcctg
ccgcttacgctcaatacgccaacggtactcaatgccagccttaatttccgacagttctgg
aatggccgggtcgagtcactcgaggagcagggggaggccgtgatcaccagcgctcacgag
atgggcggagactggcgcgtgatcgagcagcgcatcgccgcagacgtgcattaccgtcag
gggttcaaggatgcctacccggacgcggtgacaaaggacaacatcctcagcgcgttggcc
gattaccaaaggacgcttcttacccctggcgcacgcttcgatcgttacctgcagggcgat
accgaggcgcttaccctggaggaaaaatacggctaccagcgcttcaaggactatggctgc
atcgcctgccaccaaggggtgaatattgggggcaacatgttccagaaatttggcgtgttc
ggcgactacatcgcggaccgcggccaccccaccgaggcggatcagggccgcttcaacgtg
accggagaggaggccgaccggggcgtgttcaaagtgccgagcctgcgcaatgtggcgatg
accgcgccctattttcacgatggctcggcgcctacactggagcgtgcgatcgatgtgatg
tttcagtatcagcttggacgaatcccaagtgatgaggaccgcaggctcatcatgctgttc
ctcaaaacccttactgctgaaaaggcgggtcagccatga

DBGET integrated database retrieval system