KEGG   Pseudomonas putida DOT-T1E: T1E_4053Help
Entry
T1E_4053          CDS       T02181                                 

Definition
(GenBank) Acetyl-coenzyme A synthetase 1
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ppx  Pseudomonas putida DOT-T1E
Pathway
ppx00010  Glycolysis / Gluconeogenesis
ppx00620  Pyruvate metabolism
ppx00640  Propanoate metabolism
ppx00680  Methane metabolism
ppx01100  Metabolic pathways
ppx01110  Biosynthesis of secondary metabolites
ppx01120  Microbial metabolism in diverse environments
ppx01130  Biosynthesis of antibiotics
ppx01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ppx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    T1E_4053
   00620 Pyruvate metabolism
    T1E_4053
   00640 Propanoate metabolism
    T1E_4053
  Energy metabolism
   00680 Methane metabolism
    T1E_4053
Enzymes [BR:ppx01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     T1E_4053
Lipid biosynthesis proteins [BR:ppx01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   T1E_4053
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: AFO49882
UniProt: I7C0C7
Position
complement(4425417..4427567)
Genome map
AA seq 716 aa AA seqDB search
MTESVTILWQTPRFFVGKAVMPAPERFAGTGVPNYYQRRMAFVALVQLQTVPYKNNYYTE
VTQMSAAPLYPVRPEVAATTLTDEATYKAMYQQSVINPDGFWREQAQRIDWIKPFTKVKQ
TSFDDHHVDIKWFADGTLNVSSNCLDRHLEERGDQLAIIWEGDDPSEHRNITYRELHEQV
CKFANALRGQDVHRGDVVTIYMPMIPEAVVAMLACARIGAIHSVVFGGFSPEALAGRIID
CKSKVVITADEGVRGGRRTPLKANVDLALTNPETSSVQKIIVCKRTGGDIAWHQHRDIWY
EDLMKVASSHCAPKEMGAEEALFILYTSGSTGKPKGVLHTTGGYLVYAALTHERVFDYRP
GEVYWCTADVGWVTGHSYIVYGPLANGATTLLFEGVPNYPDITRVSKIVDKHKVNILYTA
PTAIRAMMAEGQAAVEGADGSSLRLLGSVGEPINPEAWNWYYKTVGKERCPIVDTWWQTE
TGGILISPLPGATGLKPGSATRPFFGVVPALVDNLGNLIDGAAEGNLVILDSWPGQSRSL
YGDHDRFVDTYFKTFRGMYFTGDGARRDEDGYYWITGRVDDVLNVSGHRMGTAEIESAMV
AHSKVAEAAVVGVPHDIKGQGIYVYVTLNAGIEASEQLRLELKNWVRKEIGPIASPDVIQ
WAPGLPKTRSGKIMRRILRKIATGEYDALGDISTLADPGVVQHLIDTHKAMNLASA
NT seq 2151 nt NT seq  +upstreamnt  +downstreamnt
ttgacagaatctgtaacaatcctgtggcaaacccctcgttttttcgtcggcaaggctgta
atgcccgcgccagagcgttttgccggaacgggtgtgccaaattactaccaacgtcgaatg
gcttttgtcgctctggtacagttacaaacggttccatacaaaaacaactattacaccgag
gtaacacagatgagtgcggctccactgtatcccgttcgtcccgaggttgcggccactacc
ctgaccgacgaggccacctacaaggccatgtaccagcaatcggtgatcaacccggacggc
ttctggcgcgagcaggcccagcgtatcgactggatcaagccgttcaccaaggtcaagcag
acctccttcgacgaccaccatgtcgatatcaaatggttcgccgacggcactctgaacgtt
tcctccaactgcctggaccgccaccttgaagagcgcggtgaccagttggccatcatctgg
gaaggtgacgacccttccgagcaccgcaacatcacttaccgcgagttgcacgagcaggtc
tgcaagttcgccaacgccctgcgtggccaggatgtgcaccgcggtgacgtggtcaccatc
tatatgccgatgatccccgaagcggtggtcgccatgctggcctgtgcacgcattggtgcg
attcactcggtggtgttcggcggcttctcgcccgaggcgctggctggccgtatcatcgac
tgcaagtccaaggtggtgatcacggccgacgaaggcgtgcgtggtggccgccgcacaccg
ctcaaggccaacgtcgacctggcgctgaccaaccctgaaaccagcagcgtgcagaaaatc
atcgtgtgcaagcgcaccggtggcgacattgcctggcaccagcaccgcgacatctggtac
gaagacctgatgaaagtcgcctccagccactgcgcacccaaggaaatgggcgctgaagag
gcgctgttcatcctttatacctccggctccaccggcaagccgaagggcgtgctgcacacc
acgggcggttacctggtttacgccgcgctgacccatgaacgcgtattcgattaccgcccg
ggcgaggtgtactggtgcaccgccgacgtcggttgggtcacaggccacagctatatcgtc
tacggcccgctggccaacggcgctaccaccttgctgttcgagggcgtgccgaactacccg
gacattacccgcgtatcgaagatcgtcgacaagcacaaggtcaacatcctctacacagcg
ccaactgccattcgcgccatgatggctgaagggcaggcagctgttgagggcgccgacggt
tccagcctgcgtctgctggggtcggtgggtgagccgatcaaccctgaggcctggaactgg
tactacaagaccgtcggcaaggagcgttgcccgatcgtcgacacctggtggcagaccgag
accggcggcatcctgatcagcccgctgcctggcgccaccggcctcaagccgggttcggca
acccgtccgttcttcggtgtggtgcctgccctggtcgataacctgggcaacctgatcgac
ggtgctgccgaaggcaacctggtaatcctcgattcctggccgggtcagtcgcgttcgttg
tacggcgaccatgaccgcttcgtcgacacctacttcaagaccttccgtggcatgtatttc
accggcgacggtgcgcgccgcgacgaggacggctactactggatcaccggccgtgtggat
gacgtgctcaacgtgtccggccaccgcatgggtactgccgagatcgaaagcgccatggtt
gcgcattcgaaggttgccgaggccgcagtggttggcgtgccgcatgacatcaaagggcag
ggcatttatgtgtatgtcaccctcaatgccggcatcgaggccagcgagcaattgcgcctg
gagctgaagaactgggtacgcaaggagattggcccgattgcctcgccggatgtgatccag
tgggcgccagggctgccgaagacccgctcgggcaagatcatgcgccgcatcctgcgcaag
attgcgaccggtgaatacgacgccctgggcgatatctcgaccttggccgacccaggtgtg
gtgcagcacctgatcgatacccacaaggcgatgaacctggcttcggcctaa

DBGET integrated database retrieval system