KEGG   Pseudomonas putida DOT-T1E: T1E_4257Help
Entry
T1E_4257          CDS       T02181                                 

Gene name
amnH
Definition
acetaldehyde dehydrogenase
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
ppx  Pseudomonas putida DOT-T1E
Pathway
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:ppx00620]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:ppx00650]
Metabolism; Xenobiotics biodegradation and metabolism; Benzoate degradation [PATH:ppx00362]
Metabolism; Xenobiotics biodegradation and metabolism; Xylene degradation [PATH:ppx00622]
Metabolism; Xenobiotics biodegradation and metabolism; Dioxin degradation [PATH:ppx00621]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4634169..4635113
Genome map
AA seq 314 aa AA seqDB search
MQTHDGKTAVAIIGSGNIGTDLMVKILRHGKHLRMGAFVGIDPESDGLKRAERMGVPTVS
TGIEGLLSHPDFGSIGFVFDATSAGAHARHEQLLRPHGVRVIDLTPAAIGPFVVPAVNIE
QHLDAPNVNMVTCGGQATIPMVAAVSRVVPVEYAEIVASISSRSAGPGTRANIDEFTETT
SNAIVRVGGAQRGKAIIILNPAEPPLIMRDTVYCLVPGHADRQAIVESVERMASAVAAYV
PGYRLKQTVQFDEFKGRMPQETGSAQAPRLKVSVFLEVEGAGHYLPSYAGNLDIMTSAAL
ATAERIAARQPVAA
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacacatgatggtaagaccgcagtggccattatcggttcgggcaacatcggcacc
gatctaatggtgaaaatccttcgccatggcaaacacctgagaatgggggccttcgtcggc
atcgatccggagtccgatggtctcaagcgcgccgaacggatgggcgtgcccacggtgagc
accggcatcgaaggattattgtcccaccccgatttcggctccatcggcttcgtattcgat
gccaccagtgccggcgcgcatgcacgtcacgagcaactgctgcggccgcacggcgtacgc
gtgatcgatctgacaccggcggcgatcgggccgttcgtggtgcccgcagtgaatatcgaa
cagcatctggatgcgccgaacgtcaacatggtgacctgtggtggccaggcgacgattcct
atggttgctgctgtttcgcgcgtcgtgccagtcgagtacgccgagattgtcgcttccatt
tccagtcgttcggccggaccgggcacgcgggcgaacattgacgagttcaccgagaccacc
tccaacgccatcgttcgcgtaggtggggcccagcgtggcaaggcaatcatcatcctcaat
ccggcagagcctccgctgatcatgcgcgacaccgtctactgcctggtgccgggccatgcg
gatcggcaagcgatcgtcgagtcggtcgagcgtatggcttccgcagtggcggcatacgtg
cctggatatcggctcaagcagaccgtgcagttcgatgagttcaagggccgcatgccgcag
gaaactggaagcgcacaagcaccccgtctcaaggtctcagtgttcctcgaagtcgagggc
gccggacattacctgccgagctatgccgggaatctggacatcatgaccagcgctgcgctg
gcgacggccgagcgcatcgctgcccgtcagccggtggctgcgtaa

DBGET integrated database retrieval system