KEGG   Pseudomonas putida DOT-T1E: T1E_4273Help
Entry
T1E_4273          CDS       T02181                                 

Gene name
tobI
Definition
(GenBank) Acetaldehyde dehydrogenase
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
ppx  Pseudomonas putida DOT-T1E
Pathway
ppx00360  Phenylalanine metabolism
ppx00362  Benzoate degradation
ppx00620  Pyruvate metabolism
ppx00621  Dioxin degradation
ppx00622  Xylene degradation
ppx00650  Butanoate metabolism
ppx01100  Metabolic pathways
ppx01120  Microbial metabolism in diverse environments
ppx01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ppx00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    T1E_4273 (tobI)
   00650 Butanoate metabolism
    T1E_4273 (tobI)
  Amino acid metabolism
   00360 Phenylalanine metabolism
    T1E_4273 (tobI)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    T1E_4273 (tobI)
   00622 Xylene degradation
    T1E_4273 (tobI)
   00621 Dioxin degradation
    T1E_4273 (tobI)
Enzymes [BR:ppx01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     T1E_4273 (tobI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh GFO_IDH_MocA F420_oxidored
Motif
Other DBs
NCBI-ProteinID: AFO50102
UniProt: I7C122
Position
4648129..4649079
Genome map
AA seq 316 aa AA seqDB search
MTRKVKAAIIGSGNIGTDLMIKILRHGQHIEMGAMVGIDPASDGLARAQRMGVAITHEGV
EGLTRLPVFNEIDVVFDATSAGAHVKNEALLRERKPGLRMIDLTPAAIGPYCIPVVNGDD
HLDATNVNMVTCGGQATIPMVAAVSRVAKVHYAEIIASISSKSAGPGTRANIDEFTETTS
KAIEVVGGAAKGKAIIVLNPAEPPLMMRDTVYTLSDFADIDQIEESVQRMADAVQAYVPG
YRLKQRVQFDRIEADCPIRIPGVGDRMNGLKTSIFLEVEGAAHYLPAYAGNLDIMTSAAL
RTAEKLAERLLASLVA
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgacccgcaaagtcaaggctgccatcattggtagcggtaatatcggcaccgacctgatg
atcaagatactcaggcatggtcaacacattgaaatgggagcgatggtcggcatcgacccc
gcttctgacggtctggcacgcgcccaacgcatgggggtggctatcactcatgaaggtgtc
gaggggctgacgcgcctgccggtgttcaatgagatcgacgtcgtgttcgacgctactagt
gctggtgcgcatgtgaagaacgaggccctactgcgtgagcgcaagccaggactgcgcatg
atcgacctgacacccgccgcgatcggcccctattgcatccccgtggtcaatggtgacgac
cacctggatgcgacgaacgtcaatatggtcacctgtggcggccaggccaccatccccatg
gtggctgcggtatcgcgcgtagccaaggtgcattacgccgaaatcatcgccagcatctcc
agcaagagcgccggccccggcacgcgcgccaacatcgatgagttcaccgagaccacgtcc
aaggccatcgaggtggttggcggggcggcgaagggcaaggcgatcatcgtcctgaacccg
gccgagccgccgctgatgatgcgagatacggtttacacgctgagcgacttcgctgacatc
gaccagatcgaagagtcggtgcagcgcatggccgacgcagtgcaggcatacgtacccggc
tatcgcctgaagcagcgcgtgcagttcgaccgcatcgaggccgattgtccgatccgcatt
cctggcgtcggagaccgcatgaacgggctcaagacttcgatcttcctggaagtcgagggc
gctgcacactacctgccagcttatgccggcaacctggacatcatgaccagtgccgcgctg
cgcaccgccgagaagttggctgagcgtttgctcgcctccctggtcgcctga

DBGET integrated database retrieval system