KEGG   Pseudomonas putida DOT-T1E: T1E_4686Help
Entry
T1E_4686          CDS       T02181                                 

Gene name
mutM
Definition
Formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
ppx  Pseudomonas putida DOT-T1E
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:ppx03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5117220..5118032)
Genome map
AA seq 270 aa AA seqDB search
MPELPEVETTRRGIAPHLEGQRVSRVVVRDRRLRWPIPEDLDVRLSGQRIVSVERRAKYL
LINAEVGTLISHLGMSGNLRLVELGLPAAKHEHVDIELESGLMLRYTDPRRFGAMLWSLD
PLNHELLLRLGPEPLTDLFDGERLFQLSRGRSMAVKPFIMDNAVVVGVGNIYATEALFAA
GIDPRREAGGISRARYLKLATEIKRVLAAAIEQGGTTLRDFIGGDGQPGYFQQELFVYGR
GGQPCKVCGTELREVKLGQRASVYCPRCQR
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgccggaattgccagaagtagaaaccacccggcgcggtattgcgccacacctggaaggc
cagcgcgtcagccgtgtggtggtacgcgaccggcgtctgcgctggccgattccggaagac
ctcgatgtgcgcctgtcagggcagcgcatcgtcagcgtggagcgacgtgccaagtacctg
ttgatcaatgccgaagtgggtacgctgatcagccacttgggcatgtcgggcaacctgcgg
ctggtcgagctgggcttgccggcggccaagcatgagcatgtcgacatcgagctggagtcc
gggctgatgctgcgctacaccgacccgcgccgctttggtgccatgctgtggagcctggac
cctctgaaccatgagctactgctgcgcctggggcctgagccgctgaccgacctgttcgat
ggtgaacggctgttccagctgtcccgcgggcggtcgatggcggtcaagccgttcatcatg
gacaacgcggtggtggtaggggtgggcaacatctacgccaccgaggcgttgtttgccgcc
ggtatcgacccacgccgggaggcgggcgggatttcccgggcgcgctacctgaagctggcg
accgagatcaaacgggtgctggcggcggccatcgagcagggcggtaccaccctgcgcgac
tttatcggtggcgacgggcagccggggtacttccagcaggaactgtttgtgtacgggcgt
ggcgggcagccgtgcaaggtatgcggcactgagttgcgcgaagtgaagctggggcagagg
gcgagcgtgtactgcccgcgctgccaacgatga

DBGET integrated database retrieval system