KEGG   Pseudomonas putida DOT-T1E: T1E_4704Help
Entry
T1E_4704          CDS       T02181                                 

Definition
phosphomannomutase/phosphoglucomutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
ppx  Pseudomonas putida DOT-T1E
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ppx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    T1E_4704
   00030 Pentose phosphate pathway
    T1E_4704
   00051 Fructose and mannose metabolism
    T1E_4704
   00052 Galactose metabolism
    T1E_4704
   00500 Starch and sucrose metabolism
    T1E_4704
   00520 Amino sugar and nucleotide sugar metabolism
    T1E_4704
  Nucleotide metabolism
   00230 Purine metabolism
    T1E_4704
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    T1E_4704
Enzymes [BR:ppx01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     T1E_4704
    5.4.2.8  phosphomannomutase
     T1E_4704
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5143133..5144533
Genome map
AA seq 466 aa AA seqDB search
MNDMAHLVPAALPDSIFRAYDIRGVVGKTLHAETAYWIGRAIGAQSLAQGEPQVSVGRDG
RLSGPMLVEQLIKGLVDAGCHVSDVGLVPTPALYYAANVLAGKSGVMLTGSHNPSDYNGF
KIVIAGDTLANEQIQALLTRLKTNDLTLAQGRVEKVEILDRYFQQIVGDVKLAKKLKVVV
DCGNGAAGVVAPQLIEALGCEVIPLFCEVDGNFPNHHPDPGKPENLEDLIAKVKETGADI
GLAFDGDGDRVGVVTNTGSIVYPDRLLMLFAQDVLSRNPGAEIIFDVKCTRRLTPLIEQH
GGSALMWKTGHSLIKKKMKQTGSLLAGEMSGHIFIKERWYGFDDGIYSAARLLEILSKTQ
QSAENLFAAFPNDISTPEINIDVTDEGKFSIIDALQRDADWGEAHLTTIDGVRVDYANGW
GLVRASNTTPVLVLRFEADSDAELQRIKDVFRTQLLRVEPELQLPF
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacatggcccacctggtccccgccgcattgcccgacagcattttccgcgcatat
gacatacgcggcgtggtcggcaagacccttcacgccgaaaccgcctactggatcggccgc
gccatcggcgcgcaaagcctggcccagggcgaaccgcaggtttcggtagggcgcgatggc
cgcctgtcgggcccgatgctggtggaacagctgatcaagggcctggtcgatgcgggctgc
cacgtcagcgacgtcggcctggtgcctaccccggcgctgtactacgcagccaacgtgctg
gccggcaagtccggtgtgatgctgactggcagccacaacccttcggactacaacggtttc
aagatcgtcatcgccggtgacaccttggccaacgaacagatccaggccctgctgacccgc
ctgaaaaccaacgacctgaccctggcccaaggccgcgtggaaaaggtcgagatcctcgac
cgctacttccagcagatcgtcggcgacgtaaagctggcgaaaaagctcaaggtggtggtg
gactgcggcaacggcgccgctggcgtggttgcaccgcaactgatcgaagccctgggctgc
gaagtgatcccgctgttctgcgaggtcgacggcaacttccccaaccaccacccggacccg
ggcaagccggagaacctcgaagacctgatcgccaaggtcaaggaaaccggtgccgatatc
ggcctggccttcgacggtgacggcgaccgtgtcggcgtggtgaccaacaccggcagcatc
gtctaccccgaccgcctgctgatgctgtttgcccaggacgtgctgtcgcgcaacccaggt
gccgagatcatcttcgacgtcaaatgcacccgccgcctgaccccgctgatcgaacagcac
ggtggcagcgccttgatgtggaaaaccggccattcgctgatcaagaagaagatgaagcag
accggttcgctgctggcaggcgagatgagcggtcacatcttcatcaaggaacgttggtac
ggttttgacgacggtatctacagcgccgcgcgcctgttggagatcctcagcaagacccag
cagagcgccgaaaacctgtttgccgccttcccgaacgatatttccacgccggaaatcaat
attgatgtgaccgacgagggtaaattcagcatcattgatgcactgcaacgcgacgccgac
tggggcgaagcccacctgaccaccattgacggtgtgcgggtcgactacgccaatggctgg
ggcctggttcgcgcctccaacaccaccccggtgctggtgctgcgcttcgaggccgacagc
gacgccgagttgcaacgtatcaaggatgttttccgcacccagttgctgcgggtagagcct
gagctgcaactgccgttctga

DBGET integrated database retrieval system