KEGG   Pseudomonas putida DOT-T1E: T1E_4733Help
Entry
T1E_4733          CDS       T02181                                 

Gene name
speB
Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
ppx  Pseudomonas putida DOT-T1E
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppx00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    T1E_4733 (speB)
Enzymes [BR:ppx01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     T1E_4733 (speB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5170969..5171934
Genome map
AA seq 321 aa AA seqDB search
MDQAASNDQAMTRDSLYGTAAESTYAGVVSFSRRRYSRDLRGVDVVVSGVPFDTATSNRP
GARFGPRAIRAASVQQAWARHWPWAFDPFDHLAVIDYGDCPFDSGTPQSVPDSIEAHAEH
ILQAGCAMLTLGGDHFISYPLLKAHARRHGPLALIHFDAHSDTWPDEAGKRIDHGTMFWH
AAREGLVDPAHSVQIGLRTTNDDSQGFAILDARQVHRQGTEAVIAAIRQRVGERPVYLTF
DIDCLDPAYAPGTGTPVCGGLSTVQALEILGGLRGINLVGMDLVEVAPAYDHADITALAG
ATLAMEMLCLYAARHKVDNGQ
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
gtggaccaagccgcaagcaatgaccaggccatgacccgcgatagcctgtatggtaccgcc
gcagaaagcacctacgccggtgttgtcagtttttcccgccgccgctacagccgcgacttg
cgcggtgtggatgtggtggtcagcggtgtgccgttcgacacggccaccagtaaccgcccc
ggcgcgcgcttcggcccgcgggcgatccgtgctgcctcggtccagcaggcctgggcccgc
cactggccgtgggcgttcgacccgttcgaccacctggcggtcatcgactatggcgactgc
cccttcgacagcggcacgccgcagtcggtaccggacagcatcgaggcccatgccgagcac
attctgcaggcgggttgcgccatgctgacccttggtggcgaccacttcatcagctacccg
ctgctcaaggctcacgcccgccgccatggcccgctggcgctgatccatttcgatgcgcac
agtgacacctggccggacgaggcgggtaagcgcatcgaccacggcaccatgttctggcat
gccgcccgcgaaggcctggttgacccggcccactcggtgcagattggcctgcgcacgacc
aatgacgacagccagggctttgccattctcgacgccaggcaggtgcaccgccagggcaca
gaggcggtgattgcagcgattcgccagcgggtgggcgagcggccggtgtacctgaccttc
gacatcgactgcctcgacccggcctacgcgcccggtaccggaacgccggtgtgtggcggg
ctgagcacggtgcaggcgctggagattctgggtgggctgcgtggcatcaacctggtaggc
atggacttggtggaagtggcgccagcctatgaccatgccgatatcactgcattggccggg
gcaaccctggccatggagatgctgtgcctgtatgcggcgcggcataaggtggataacggc
cagtag

DBGET integrated database retrieval system