KEGG   Pseudomonas putida DOT-T1E: T1E_4752Help
Entry
T1E_4752          CDS       T02181                                 

Gene name
yneF
Definition
(GenBank) diguanylate cyclase
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
ppx  Pseudomonas putida DOT-T1E
Brite
Enzymes [BR:ppx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     T1E_4752 (yneF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(5190426..5192363)
Genome map
AA seq 645 aa AA seqDB search
MTEDAERWKEKYLKSIEQQEKLERRWDARLDLLRRGLVRSTLAAEGSDKVVDECMKEMRD
VIRSDNMDAGLAGLIPRLEKAVLDSEQRRETRMNQVSDALTALVGQLQGLPLPSDISRPL
KKLAKKLDGGVAQSRELPPLLGELSGLQGRALSALGKPGEEARPGFLQRLFGSREEDAQA
GAELAPVALPAAEVVPQAAGSGEPSRPDDVDALQPLPAPAAPTAEVAEAPELELEAFGPA
LIETAEMAPAPLPRDKALLPEAAVSASEPLAEAEPLQALEETFGEDGPYALPYAVEPPYS
QVAAHIEQTLIGLLDDLSLPERHKAQALEMRERVARGLNWYELIPVLDDLAVLMLAITDS
GQHEFETYLQQLNERLEGFQSHLHEASAGHADNSTAARELDSQLREHVDGLQSSVQGAAD
VDSLKHILENRLEGLLLTMDEHKHERDRREQELAGRLQGLSERVASMEHEALGYREHLEE
QRQKALLDPLTGLPNRAAWSEQVEREMLDWQENGGHLAMAILDLDHFKRINDNYGHLAGD
KVLKIVADQLRKRLRGRDFIARFGGEEFVLLLPQTTPAVAAQMAEVLRATVEACPFHFKG
ERVVITTSIGLGAFRSGERSDQVLKRADAALYRAKEQGRNRVEQG
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atgactgaagacgctgagcgctggaaagaaaaataccttaaaagcatcgagcagcaagaa
aagctcgaacgccgttgggatgcccgtcttgacctgctgcgtcgaggcctggtgcgcagc
accctggctgctgaaggcagtgacaaggtggtagacgagtgcatgaaggaaatgcgcgat
gtcattcgcagcgacaacatggacgccggcctcgccggcttgattccgcgccttgagaaa
gcggtactggattccgaacagcgtcgcgaaacccgcatgaaccaagtcagcgatgcgctg
accgcactggttggccaactgcaaggcctgcccctgcccagtgatatctcgcggccattg
aaaaaactggcgaagaagctcgacggcggggttgcccagtcacgcgagctgccgccgctg
ttgggcgagttgagcggcttgcaggggcgcgcgctgtcggcccttggcaagccgggtgaa
gaagcccgacccgggtttctgcagcggttgttcggaagccgcgaggaagatgcacaggca
ggagcagagcttgcgccggtggcgttgcctgctgccgaggttgtgccccaggcagccggc
agtggcgagccctcgcggcccgatgacgtcgatgcgctacaaccgttgccggcccctgct
gctccgactgccgaggtggccgaagcgcccgagcttgagctggaggcatttggcccagcg
ctgatcgaaacggccgaaatggcgccagccccgttgccaagggacaaggcgctattgccg
gaagctgcagtttccgccagcgagccattggctgaggcagaacccttacaagcccttgaa
gaaaccttcggtgaagacggcccctatgccctgccctacgcagtggagccgccttacagc
caggttgccgcgcacatcgagcagaccctgatcggtctgctcgatgaccttagcctgccc
gagcgccacaaggctcaggcgttggaaatgcgcgagcgggttgctcgcggcttgaactgg
tatgagctgatcccggtgctggatgacttggcagtcctcatgctggcgatcaccgacagc
ggccagcacgaattcgaaacctacctgcagcagctcaatgaacgcctggaaggtttccag
agccacctgcacgaggccagcgccggtcacgcggacaacagcaccgctgcccgcgagctg
gatagccagctgcgtgagcacgtcgacggcctgcaaagcagcgtgcaaggtgccgccgat
gtagacagcctcaagcacattctggaaaaccgcctggaaggcttgctgctgaccatggac
gagcacaagcacgagcgtgatcgccgcgagcaggaactggccggtcgcctgcaaggcttg
tcggagcgggtggcgagcatggagcatgaggcgcttggctatcgcgaacacctggaagaa
cagcgccagaaagcgctgctggacccgctcaccggcctgcccaaccgtgcggcctggagc
gagcaagtcgaacgcgaaatgcttgactggcaggaaaacggcggtcatctggcgatggcg
attcttgacctggaccatttcaaacgcatcaacgacaactatggtcatctggctggggac
aaggtcctcaagatcgtggccgaccagttgcgcaagcgtctgcggggccgggatttcatc
gcccgttttggcggcgaggaattcgtcttgctgttgccgcagactacgcccgcagtcgct
gcgcagatggccgaggtgttgcgcgccacagtcgaggcctgcccattccacttcaagggt
gagcgggtagtgatcaccacctccatcggcctgggtgcattccgttctggcgaacgcagc
gatcaggtgctcaaacgagccgatgcagcgctgtaccgggcaaaggagcaggggcgtaat
cgcgtcgagcaaggctag

DBGET integrated database retrieval system