KEGG   Pseudomonas putida DOT-T1E: T1E_4972Help
Entry
T1E_4972          CDS       T02181                                 

Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
ppx  Pseudomonas putida DOT-T1E
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5422831..5423505
Genome map
AA seq 224 aa AA seqDB search
MREDDMLRRGIGMTSQRTRERLIQRLCEEGVSNTKVLDVIRRTPRHLFVDEALAHRAYED
TALPIGHNQTISQPFMVAHMSELLLEAGPLDKVLEIGTGSGYQTAILAQLVERVFSVERI
KVLQDRAKERLVELNLRNVVFRWGDGCEGWPALAPYNGIIVTAVAPEVPQALLDQLAPGG
RMVIPVGPAGEAQQLMLIVREEHGFSRRVLGAVRFVPLLNGPLA
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgaggacgatatgctgcggcgtggcatcggcatgacctctcagcgtacccgggag
cggctgatacagcgtttgtgcgaagagggggtttcgaacaccaaggtgctcgacgtgatc
cgtcgtacgccgcgccacctgttcgtcgacgaggcgctggcgcatcgagcatacgaagac
accgcgctgccgatcggccacaaccagaccatctcccagccgttcatggttgctcacatg
agcgagctgttgctcgaggccgggccgctggacaaggtgctggagattggcaccggttcg
ggctaccagacggcgatcctggctcagctggtcgagcgggtgttttcggtagagcgcatc
aaggtgctgcaggaccgggccaaagagcgcctggtggagcttaacctgcgcaacgtggta
ttccgctggggtgacggttgtgaggggtggccggcgcttgcgccgtacaacggcatcatc
gtcaccgccgtggcgccggaagtgccacaggcactgctcgaccaactggcacccggtgga
cgcatggtcattccggtagggccggccggcgaagcgcagcaactgatgctgatcgtgcgc
gaggagcatggattctcccgtcgcgtactgggggctgtgcgcttcgtgccgctgctcaat
gggcctctggcctga

DBGET integrated database retrieval system