KEGG   Pseudomonas putida DOT-T1E: T1E_5014Help
Entry
T1E_5014          CDS       T02181                                 

Gene name
aceA
Definition
Isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
ppx  Pseudomonas putida DOT-T1E
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:ppx01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:ppx00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5460357..5461682
Genome map
AA seq 441 aa AA seqDB search
MALTREQQIAALEKDWAENPRWKGVTRTYTAADVVRLRGSVQPEHTFARQGAEKLWKLVT
EGAHPSFRPDKDFVNCMGALTGGQAVQQVKAGIQAIYLSGWQVAADNNSAESMYPDQSLY
PVDSVPTVVKRINNAFRRADQIQWKAGKNPGDEGYIDYFAPIVADAEAGFGGVLNAYELM
KNMIEAGAAGVHFEDQLASVKKCGHMGGKVLVPTQEAVQKLVAARLAADVSGVPTIILAR
TDANAADLLTSDCDPYDQPFVVGERTREGFYKVRAGLDQAIARGLAYAPYADLIWCETAK
PDLDEARRFAEAIKKEYPDQILSYNCSPSFNWKKNLDDATIAKFQRELSAMGYKHQFITL
AGIHNMWHGMFNLAHDYARNDMTAYVKLQEQEFADASKGYTFVAHQQEVGTGYFDDMTTV
IQGGASSVTALTGSTEEEQFH
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atggcactgacacgcgaacagcaaattgcagccctcgagaaagactgggccgagaacccg
cgctggaaaggcgtgacccgtacctacaccgccgctgatgtcgttcgcctgcgtggctcc
gtgcaacctgagcacacctttgcccgtcagggtgcagaaaaactgtggaagctggtcacc
gaaggtgctcacccgtccttccgccccgacaaagatttcgtcaactgcatgggcgccctg
accggcggccaggctgtacaacaggtcaaggccggcatccaggccatctacctgtccggc
tggcaggttgccgccgacaacaactcggccgagtcgatgtaccctgaccagtcgctgtac
ccggtcgactcggtaccgaccgtggtcaagcgcatcaacaacgcgttccgccgcgccgac
cagatccagtggaaagccggcaagaacccgggcgacgaaggctacatcgactacttcgcg
ccgatcgtggccgacgccgaagccggtttcggtggcgtactgaacgcctacgagctgatg
aagaacatgatcgaagcaggtgccgccggcgtgcacttcgaagaccaactggcctcggtg
aaaaaatgcggccacatgggcggcaaggtgctggtgccgactcaggaagccgtacagaag
ctggtagcagcgcgcctggccgctgacgtatcgggcgtgccgaccatcatcctggcccgt
accgacgccaacgccgccgacctgctgaccagcgactgcgacccgtacgaccagccgttc
gtggttggcgagcgcacccgcgaaggcttctacaaggtacgcgccggcctcgatcaggcc
attgcccgcggcctggcctacgccccgtacgccgacctgatctggtgcgaaactgccaag
ccagacctggacgaagcccgccgcttcgccgaggcgatcaagaaggagtacccggaccag
atcctgtcgtacaactgctcgccttccttcaactggaagaaaaacctggacgacgccacc
atcgccaagttccagcgcgagctgtcggccatgggttacaagcatcagttcatcaccctg
gccggcatccacaacatgtggcacggcatgttcaacctggcgcacgactacgcccgcaac
gacatgaccgcctacgtgaagctgcaggagcaggaattcgctgacgccagcaagggctac
accttcgtggcgcaccagcaggaagtgggcactggctacttcgacgacatgaccaccgtg
atccagggtggcgcttcgtcggtgactgcactgaccggttcgaccgaagaagagcagttc
cactga

DBGET integrated database retrieval system