KEGG   Pseudomonas putida DOT-T1E: T1E_5050Help
Entry
T1E_5050          CDS       T02181                                 

Gene name
hisD
Definition
Histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
ppx  Pseudomonas putida DOT-T1E
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ppx01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:ppx00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5496849..5498174)
Genome map
AA seq 441 aa AA seqDB search
MTVSTAIARLNAADPDFARHLDHLLSWESVSDDAVNQRVLDIIKAVRERGDAALVEFTQR
FDGVDAKSIDDLILNRARLELALTRITPVQREALEKAANRVRIYHERQKQDSWQYTEADG
TVLGQKVTPLDRAGLYVPGGKASYPSSVLMNAIPAKVAGVAEVVMVVPTPRGEVNELVLA
AACIAGVDRVFTVGGAQAVAALAYGTESVPQVDKIVGPGNIYVATAKRHVFGQVGIDMIA
GPSEILVVCDGQTDPDWIAMDLFSQAEHDEDAQAILVSPDAAFLDRVAASIDKLMPTMER
ADIIEKSINGRGALIQVRDMQQAMDVANRIAPEHLELSVADPQAWLPHIRHAGAIFMGRH
TSEALGDYCAGPNHVLPTSGTARFSSPLGVYDFQKRSSIIFCSEQGASELGHTASVLARG
ESLTAHARSAEYRILTQEKGN
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtgtccactgcaattgcccgtctcaacgccgctgatccggatttcgctcgacat
ctggatcatctgctgagctgggaaagtgtgtccgatgacgcggtcaatcagcgcgtgctc
gacatcatcaaggccgtgcgtgaacgcggtgatgcggcgctggtggaattcacccagcgc
ttcgatggtgttgacgccaagtcgattgacgacctgatcctcaatcgcgcgcgcctggaa
ctggcgctgacccgtattacaccggtccagcgcgaggccctggaaaaggccgccaaccgt
gtgcgcatttatcacgagcggcagaagcaggattcctggcagtacaccgaggccgacggc
accgtgctcggccagaaggtcaccccgctggaccgtgctggcctgtatgtgccgggcggc
aaggcgtcgtacccgtcgtcggtgctgatgaacgccatcccggccaaggtcgcgggcgtg
gctgaggtggtgatggtggtaccgaccccgcgtggtgaggtcaacgagctggtgctggcg
gctgcctgcatcgccggtgtcgaccgggtgttcaccgtcggtggtgcccaggccgtggct
gcgctggcctacggcactgaaagcgtgccgcaggtggacaagatcgtcggcccgggcaac
atctacgttgccaccgccaaacgccacgtgttcggccaggtaggcattgacatgatcgcc
ggcccctcggaaattctcgtggtgtgcgacggtcagaccgacccggactggattgccatg
gacctgttctcccaggccgagcacgacgaagacgcccaggccatcctggtcagcccggat
gccgccttcctcgatcgtgtggctgccagcatcgacaagctgatgccgaccatggaacgt
gccgatatcatcgagaagtcgatcaatggccgtggtgcgctgatccaggtgcgtgacatg
cagcaggccatggacgtggccaaccgcattgcaccggagcacctggagctgtccgtggcc
gacccgcaagcctggctgccacacattcgccacgctggcgcgatcttcatgggccgccac
accagcgaagcgctgggcgattactgcgctggccctaaccacgtgctgcccacttcaggt
accgcgcgtttttcgtcgccgctgggggtgtatgacttccagaagcgttcgtcgatcatc
ttctgctccgaacagggcgcttccgaactgggccacactgcctcggtcctggcccgtggc
gagtcgctgaccgcccacgcccgcagcgctgaataccgtatcctgacccaagagaagggg
aactga

DBGET integrated database retrieval system