KEGG   Pseudomonas putida DOT-T1E: T1E_5052Help
Entry
T1E_5052          CDS       T02181                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
ppx  Pseudomonas putida DOT-T1E
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ppx00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:ppx00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5499188..5500453)
Genome map
AA seq 421 aa AA seqDB search
MDKLIITGGARLDGEIRISGAKNAALPILAATLLADGPVTVGNLPHLHDITTMIELFGRM
GIEPVIDEKLSVEIDPRTIKTLVAPYELVKTMRASILVLGPMVARFGEAEVALPGGCAIG
SRPVDLHIRGLEAMGAKIEVEGGYIKAKAPEGGLRGAHFFFDTVSVTGTENIMMAAALAK
GRSVLQNAAREPEVVDLANFINAMGGNIQGAGTDTITIDGVERLDSANYRVMPDRIETGT
YLVAAAVTGGRVKVKDTDPTILEAVLEKLKEAGADINTGEDWIELDMHGKRPKAVNLRTA
PYPAFPTDMQAQFISLNAIAEGTGAVIETIFENRFMHVYEMHRMGAQIQVEGNTAIVTGV
KALKGAPVMATDLRASASLVLSALVAEGDTLIDRIYHIDRGYECIEEKLQMLGAKIRRVP
G
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggacaaactgattattactggcggcgctcgccttgacggcgagatccgcatttcgggc
gcgaaaaacgcagccctgccgattctggcagcgaccctgctggccgatggcccggtcacc
gtgggcaacctgccgcacctgcacgacatcaccaccatgatcgagctgttcgggcgcatg
ggcatcgagcctgtgatcgacgaaaagctgtcggtggagatcgatccacgcaccatcaag
accctggtcgcgccgtacgagctggtcaagaccatgcgcgcctcgatcctggtgctgggc
ccgatggttgcccgtttcggcgaagccgaagtggccctgcctggcggttgcgccattggc
tcgcgcccggtcgatctgcacatccgtggccttgaggccatgggggcgaagatcgaagtg
gagggcggctacatcaaggccaaggcgcctgaaggtggcctgcgtggcgcgcacttcttc
ttcgacaccgtcagcgtgaccggtaccgagaacatcatgatggccgctgccttggccaag
ggccgcagcgtgttgcagaacgccgcgcgtgagcctgaagtggtcgatctggccaacttc
atcaacgcgatgggcgggaacattcagggcgcaggtaccgacaccatcaccatcgatggt
gtcgaacgactggattcggccaactaccgcgtcatgccggaccgcatcgagaccggtacc
tacctggttgccgctgccgtgaccggtggccgcgtcaaggtcaaggacaccgaccctacc
atccttgaagccgtgcttgaaaaactcaaggaagcgggtgccgacatcaacaccggcgag
gactggatcgagctggacatgcatggcaagcggccgaaagccgtgaacctgcgtactgcc
ccgtatccggcgttcccgaccgacatgcaggcgcagttcatctcgctgaacgccattgcc
gaaggcactggcgcggtaatcgagaccatcttcgaaaaccgcttcatgcatgtttacgaa
atgcaccgcatgggcgcgcagatccaggtcgaaggcaacaccgccatcgttactggcgtc
aaggcgctgaagggtgccccggtcatggccaccgacctgcgtgcttccgccagcctggtg
ctgtcggcgctggttgccgaaggcgataccctgatcgatcgcatctaccacatcgaccgt
ggttacgagtgcatcgaggaaaaactgcagatgctcggcgcgaaaatccgccgcgtaccg
ggctag

DBGET integrated database retrieval system