KEGG   Pseudomonas putida DOT-T1E: T1E_5169Help
Entry
T1E_5169          CDS       T02181                                 

Definition
GTP cyclohydrolase 1 1
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
ppx  Pseudomonas putida DOT-T1E
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ppx00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5625456..5626001)
Genome map
AA seq 181 aa AA seqDB search
MSLEQNYTEILSQIGEDVSREGLLDTPKRAAKAMKYLCRGYEQTLEEVTNNALFSSDNSE
MVLVRDIELYSMCEHHMLPFIGKAHVAYLPKGKVLGLSKVARIVDMYARRLQIQENLSRQ
IAEAVQQVTGAAGVAVVVEAKHMCMMMRGVEKQNSTMITSVMLGEFRDNAATRSEFLSLI
K
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgtccctggaacagaactacaccgagatcctcagccagattggcgaggacgtctcccgt
gagggcctgctcgacacgcccaagcgggctgcaaaggcgatgaagtacctttgccgcggt
tatgagcaaacactggaagaagtcaccaacaacgctttgttcagctctgacaacagcgaa
atggtgctggtccgggacatcgagctgtattcgatgtgcgaacaccacatgctgccgttc
attggcaaggcacacgttgcctacctgccgaagggcaaggtactgggcctgtccaaggtg
gcacgtatcgtcgacatgtacgcccgccgcctgcagatccaggaaaacctcagccgccag
atcgccgaagccgtgcagcaggtaaccggtgccgcgggcgtggccgtggtggtcgaagcc
aagcacatgtgcatgatgatgcgcggtgtcgaaaagcagaattcgaccatgatcacctcg
gtgatgctgggtgagttccgcgataacgccgccacccgtagcgagttcctcagcctgatc
aagtga

DBGET integrated database retrieval system