KEGG   Pseudomonas putida DOT-T1E: T1E_5364Help
Entry
T1E_5364          CDS       T02181                                 

Gene name
pl662
Definition
arylesterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
ppx  Pseudomonas putida DOT-T1E
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:ppx01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5838974..5839579)
Genome map
AA seq 201 aa AA seqDB search
MRVWWLSAGLALYCLAQSAAAGTLLVVGDSISAGFGLDSRQGWVSLLQARLRDEGFDDKV
VNASISGDTSAGGQARLPALLAAHKPSLVVLELGGNDGLRGQPPAQLQQNLASMIERSRQ
AGAKVLLLGMRLPPNYGVRYTTAFAKVYEQLAADKQVPLVPFFLEGVGGVPELMQADGIH
PAQGAQQRLLENAWPAIKPLL
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcgagtgtggtggttgagtgccggtctggccctgtattgcctggcccagagcgcagcg
gcaggaacactgctggttgttggcgatagtatcagcgccggttttggcctggatagccgt
cagggctgggtgtctctcttgcaggcccgtctcagggacgaaggttttgacgacaaagtg
gtcaatgcttcgatcagtggcgataccagcgcaggtggccaggcgcggctcccggcgctg
cttgcagcacataaaccaagcctggtggtgctggagctgggcggcaacgatggcctgcgc
gggcagccgcctgcacaattgcaacaaaatcttgcctcgatgatcgagcgttcgcgtcag
gcaggggccaaggtgctgctattgggcatgcgcctgccgcccaattatggtgtgcgttac
accaccgcctttgccaaggtgtatgaacagctggcagcggacaaacaggttcctttggtg
ccgtttttcctcgaaggggtagggggcgtacctgaactgatgcaggctgatggcatccat
ccggcccagggggctcagcagcgcctgctggaaaatgcctggccagcgataaaacccttg
ctgtga

DBGET integrated database retrieval system