KEGG   Pseudomonas putida DOT-T1E: T1E_5364Help
Entry
T1E_5364          CDS       T02181                                 

Gene name
pl662
Definition
arylesterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
ppx  Pseudomonas putida DOT-T1E
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:ppx00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    T1E_5364 (pl662)
Enzymes [BR:ppx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     T1E_5364 (pl662)
   3.1.2  Thioester hydrolases
    3.1.2.-  
     T1E_5364 (pl662)
Lipid biosynthesis proteins [BR:ppx01004]
 Fatty acid synthase
  Component type
   T1E_5364 (pl662)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5838974..5839579)
Genome map
AA seq 201 aa AA seqDB search
MRVWWLSAGLALYCLAQSAAAGTLLVVGDSISAGFGLDSRQGWVSLLQARLRDEGFDDKV
VNASISGDTSAGGQARLPALLAAHKPSLVVLELGGNDGLRGQPPAQLQQNLASMIERSRQ
AGAKVLLLGMRLPPNYGVRYTTAFAKVYEQLAADKQVPLVPFFLEGVGGVPELMQADGIH
PAQGAQQRLLENAWPAIKPLL
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcgagtgtggtggttgagtgccggtctggccctgtattgcctggcccagagcgcagcg
gcaggaacactgctggttgttggcgatagtatcagcgccggttttggcctggatagccgt
cagggctgggtgtctctcttgcaggcccgtctcagggacgaaggttttgacgacaaagtg
gtcaatgcttcgatcagtggcgataccagcgcaggtggccaggcgcggctcccggcgctg
cttgcagcacataaaccaagcctggtggtgctggagctgggcggcaacgatggcctgcgc
gggcagccgcctgcacaattgcaacaaaatcttgcctcgatgatcgagcgttcgcgtcag
gcaggggccaaggtgctgctattgggcatgcgcctgccgcccaattatggtgtgcgttac
accaccgcctttgccaaggtgtatgaacagctggcagcggacaaacaggttcctttggtg
ccgtttttcctcgaaggggtagggggcgtacctgaactgatgcaggctgatggcatccat
ccggcccagggggctcagcagcgcctgctggaaaatgcctggccagcgataaaacccttg
ctgtga

DBGET integrated database retrieval system