KEGG   Pseudomonas putida DOT-T1E: T1E_5725Help
Entry
T1E_5725          CDS       T02181                                 

Gene name
ruvA
Definition
Holliday junction ATP-dependent DNA helicase ruvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
ppx  Pseudomonas putida DOT-T1E
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ppx00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    T1E_5725 (ruvA)
Enzymes [BR:ppx01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     T1E_5725 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6227733..6228350
Genome map
AA seq 205 aa AA seqDB search
MIGRLRGTLAEKQPPHLIIDVNGVGYELEVPMTTLYRLPKVGETVTVHTHLVVREDAHLL
YGFAEKRERELFRELIRLNGVGPKLALALMSGLEVDELVRCVQAQDTSALVRVPGVGKKT
AERLLVELKDRFKAWETSPAMFTLVSDGPLPVASESSAEADAVSALVSLGYKPQEASKAI
AAIKDKAGLSSEELIRRSLKGMISK
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
gtgattggacgtttgcgcggcaccctggcggaaaaacaaccgcctcacctgattatcgac
gtcaacggcgtgggttacgaactggaagttcccatgaccacgctgtaccgtctgcccaaa
gtgggtgaaaccgtcacggtgcatacccacctggtcgtgcgcgaagatgcccacttgctc
tacggctttgccgaaaaacgtgagcgcgagttgttccgcgagctgatccgtctgaacggc
gtagggcctaagctggccctggcgctgatgtccgggttggaagtggatgaactggtgcgc
tgcgtgcaggcccaggacacctcagccctggtgcgcgtgccgggcgtcggcaagaaaacc
gccgagcgcttgctggtcgagctcaaggaccgtttcaaggcctgggaaacctcgccggcc
atgttcaccctggtgtccgatgggcctttaccggttgccagcgagtccagtgccgaggcc
gatgcagtcagtgccttggtctcgctgggctacaagccgcaggaagccagcaaggcaatt
gccgcgatcaaggacaaggccggcctgagcagtgaagagctgatccgccgcagcctgaaa
gggatgatttccaagtga

DBGET integrated database retrieval system