KEGG   Paenibacillus polymyxa E681: PPE_00033Help
Entry
PPE_00033         CDS       T01319                                 

Gene name
ispE
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
ppy  Paenibacillus polymyxa E681
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:ppy00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PPE_00033 (ispE)
Enzymes [BR:ppy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     PPE_00033 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
35600..36454
Genome map
AA seq 284 aa AA seqDB search
MKIYEKAPAKINLMLDVLRKRDDGYHEVEMIMTMVDLSDRLTMSELPRDTIIISSQAGYI
PLDEKNLAFQAARLIKERYNVSTGVHIHLDKHIPVAAGLAGGSSDAAAALRGLNKLWKLG
ISDAELRVLGAELGSDVPFCITGGTALASGRGELLKPLPNPPQCWVILAKPPINVSTAEV
YGRVKADQITHHPSARQMEHAIRNASFTDVCNALGNVLEDVTLKLYPEVEHLKSSMIRLG
ADGVLMSGSGPTVFGLVSKEAKVPRIYNGLRGFCKDVYAVRLLT
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaatatatgaaaaagcaccggcgaaaatcaatttaatgcttgatgttctacgtaag
cgggacgatggttatcacgaggtcgaaatgattatgaccatggtcgatctgtctgaccga
ttgacgatgtctgagttaccgcgtgataccattattatttcaagtcaagccgggtacata
ccattagatgaaaagaacttggcttttcaggctgcgcgtctgatcaaagaacgttataac
gtgtctacaggcgtccacatccatctggataagcatatcccggtggcggcagggttggcg
ggtggaagtagtgatgctgccgcagcgctgcgtggactgaacaagctatggaagcttggc
atctcggatgcagaattaagggtgctgggtgctgagctgggctcagatgtacctttctgt
attacagggggtacagctttagcgagcggacgcggagaactgctcaagccacttccgaat
ccgccacaatgctgggtgatccttgcgaagccgccgattaatgtatcgacggctgaagtg
tatggtcgtgtcaaagcagaccagattacgcaccacccgtctgcccgccagatggagcat
gcgatccgtaacgcttcttttaccgatgtatgcaacgcgctggggaatgtacttgaggat
gtaacactaaagctgtatccagaggtagagcatcttaaaagctccatgatccgcttaggg
gcagatggtgtgctgatgtcaggtagtggacctacagtgttcggactagtatcgaaggaa
gccaaagtgccacgaatttacaatggactaagagggttttgtaaagatgtatatgcagta
cgacttttgacctga

DBGET integrated database retrieval system