KEGG   Paenibacillus polymyxa E681: PPE_00068Help
Entry
PPE_00068         CDS       T01319                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
ppy  Paenibacillus polymyxa E681
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ppy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PPE_00068
Enzymes [BR:ppy01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     PPE_00068
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
72886..73752
Genome map
AA seq 288 aa AA seqDB search
MNIPTLYQRIYRMGDAELTLGHSTQIMGILNVTPDSFSDGGLHYSPEIAVLHALKLVEDG
ADIIDIGGESTRPGHDPVSVEEELARVIPVVEAIHRIAPHIPLSVDTYKAEVARQALEAG
AHIINDVWGFKADPDMARVASEFDCPVILMHNRHDRNYSDLVSDMLSDLKESIRLALDAG
VREEQIILDPGIGFAKDYDENIHAMTSLDTLSQLGFPLLLATSRKRFIRTALDLPVNDVV
EGTAATVAFGIAQGCQIVRVHDVAQIKRTVRMCDAMVYGSKNALSYGG
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
gtgaacataccgaccctttatcaacgtatttaccgaatgggggatgccgagcttacgctc
ggacattccacacagatcatgggaatactgaatgtgaccccggattcattttccgatgga
ggattacattatagtcctgagattgctgttttacatgcattgaagctggtggaagatgga
gccgatatcattgacattggcggggagtctacccgtccgggtcatgatccagttagtgtg
gaggaggaattggctcgggtcataccggtcgtcgaggccattcatcgtatcgcaccgcac
attccgttatctgtagatacttacaaagccgaagtagccaggcaggcacttgaggctggc
gcacatatcattaatgatgtgtgggggtttaaggcagaccctgatatggcacgtgtagct
tcggaattcgattgcccggtcattttgatgcataatcgtcatgatcgtaattatagtgat
ttggtttctgatatgctgtctgatttaaaagagagtatccgattagcgctggatgcgggg
gtacgtgaggaacagatcattttagacccaggcatcggttttgccaaggattatgatgaa
aatatccatgccatgacttctctcgatacattgagtcagctgggctttccgctgttattg
gctacgtcacgcaaaagatttattcgtacagcactggatttgcctgtgaatgatgtggtg
gagggcacagcggctactgttgcttttggcattgctcaagggtgccaaattgtgcgtgta
cacgatgttgcgcaaatcaagcgcaccgtacgtatgtgtgatgcgatggtgtacgggtct
aaaaatgcactgagttatggcgggtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system