KEGG   Paenibacillus polymyxa E681: PPE_00070Help
Entry
PPE_00070         CDS       T01319                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
ppy  Paenibacillus polymyxa E681
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ppy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PPE_00070
Enzymes [BR:ppy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     PPE_00070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
74339..74887
Genome map
AA seq 182 aa AA seqDB search
MNAHSTSEASEAYIALGANLGEREHTLYEAITALDEHPGIRVLRCSSLYETEPVGYLDQP
SFLNMTVAVSTTLAPEELLVYMLDVESRLGRVRHIPNGPRTIDLDLLWMEAAQLATTDLE
LPHPRMLERAFVLVPLADIVPNQDPSGLYSIVHTALNSVDGKDGIQLWKTCSWRNDSAPF
GS
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcacattcgacctctgaggcatcagaggcttatattgctttaggggctaatttg
ggggagcgcgagcataccctgtatgaagccattacggcgctggacgaacatccgggtata
cgggtgctgcggtgctccagcctgtacgaaacagagcctgttgggtatctggatcaacct
tcttttttgaacatgacggtagccgtatctacaacacttgctccagaggagcttctggta
tatatgctggatgtggagagtcgtctggggagagtaagacatattcctaatgggccacga
accattgatctggacttgttatggatggaagcggcacaactggctacaacggatttggag
cttcctcaccctcgtatgttggagcgtgcttttgtgctggttcctttggctgacatcgtt
ccgaaccaagatccgtccggtctgtacagtatcgtgcatactgcattgaattctgtggat
ggaaaggacggcatacagctttggaaaacatgcagctggcgcaacgactccgcgcctttc
ggaagctaa

DBGET integrated database retrieval system