KEGG   Paenibacillus polymyxa E681: PPE_00112Help
Entry
PPE_00112         CDS       T01319                                 

Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ppy  Paenibacillus polymyxa E681
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ppy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PPE_00112
   01230 Biosynthesis of amino acids
    PPE_00112
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PPE_00112
  Energy metabolism
   00680 Methane metabolism
    PPE_00112
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PPE_00112
Enzymes [BR:ppy01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     PPE_00112
Exosome [BR:ppy04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   PPE_00112
  Exosomal proteins of melanoma cells
   PPE_00112
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
142271..142816
Genome map
AA seq 181 aa AA seqDB search
MKKIYFVRHAQATGQEPDARLTDEGTRQAEQLADFMENVGVEYIVSSPWKRAVRTIQPLA
ERRQLQVYTDPRLQERVLSCEHLDHWLDVLEQTYLDEDLKLEGGESSREAVDRGIQLVQE
LIERAEKTVIIVTHGALLSLLIRHYDPRFGFEDWKKLSNPDVYLLELKEAEAKIHRVWNT
G
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaaaatttactttgtcagacatgcccaagcaaccggacaggaaccagatgcccgg
ctcaccgatgaaggtaccagacaagctgagcagttggctgattttatggagaatgtaggt
gtggaatatattgtgtccagcccatggaaacgggctgtgcgaaccattcagcccttggct
gagcgtagacagttgcaggtatatactgatccacgtcttcaggaacgtgtgcttagctgt
gagcatctggatcattggctggacgtgctggaacagacctatctggacgaggacttgaag
ctggagggaggggaatcatcccgtgaagcagtagatcgaggaatccagcttgttcaggag
cttatagagcgggcggaaaaaacggttatcattgtaactcatggagctttactatctctt
ctcattcgacattacgatccgcggtttgggtttgaggactggaaaaagctttcgaatccc
gacgtgtatttgctagaactgaaagaagcagaagccaagattcacagagtgtggaatacg
ggttga

DBGET integrated database retrieval system