KEGG   Paenibacillus polymyxa E681: PPE_00112Help
Entry
PPE_00112         CDS       T01319                                 

Definition
fructose-2,6-bisphosphatase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ppy  Paenibacillus polymyxa E681
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ppy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PPE_00112
   01230 Biosynthesis of amino acids
    PPE_00112
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PPE_00112
  Energy metabolism
   00680 Methane metabolism
    PPE_00112
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PPE_00112
Enzymes [BR:ppy01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     PPE_00112
Exosome [BR:ppy04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   PPE_00112
  Exosomal proteins of melanoma cells
   PPE_00112
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
142175..142816
Genome map
AA seq 213 aa AA seqDB search
MKSKCVNLHYNTKIIICKCAEYYICVTVRSDDVKKIYFVRHAQATGQEPDARLTDEGTRQ
AEQLADFMENVGVEYIVSSPWKRAVRTIQPLAERRQLQVYTDPRLQERVLSCEHLDHWLD
VLEQTYLDEDLKLEGGESSREAVDRGIQLVQELIERAEKTVIIVTHGALLSLLIRHYDPR
FGFEDWKKLSNPDVYLLELKEAEAKIHRVWNTG
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgaaatctaaatgtgtaaacctacattataacacaaaaataattatttgtaaatgtgcg
gaatactacatttgtgtgacggttaggagcgatgatgtgaagaaaatttactttgtcaga
catgcccaagcaaccggacaggaaccagatgcccggctcaccgatgaaggtaccagacaa
gctgagcagttggctgattttatggagaatgtaggtgtggaatatattgtgtccagccca
tggaaacgggctgtgcgaaccattcagcccttggctgagcgtagacagttgcaggtatat
actgatccacgtcttcaggaacgtgtgcttagctgtgagcatctggatcattggctggac
gtgctggaacagacctatctggacgaggacttgaagctggagggaggggaatcatcccgt
gaagcagtagatcgaggaatccagcttgttcaggagcttatagagcgggcggaaaaaacg
gttatcattgtaactcatggagctttactatctcttctcattcgacattacgatccgcgg
tttgggtttgaggactggaaaaagctttcgaatcccgacgtgtatttgctagaactgaaa
gaagcagaagccaagattcacagagtgtggaatacgggttga

DBGET integrated database retrieval system