KEGG   Paenibacillus polymyxa E681: PPE_00112Help
Entry
PPE_00112         CDS       T01319                                 

Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ppy  Paenibacillus polymyxa E681
Pathway
ppy00010  Glycolysis / Gluconeogenesis
ppy00260  Glycine, serine and threonine metabolism
ppy00680  Methane metabolism
ppy01100  Metabolic pathways
ppy01110  Biosynthesis of secondary metabolites
ppy01120  Microbial metabolism in diverse environments
ppy01130  Biosynthesis of antibiotics
ppy01200  Carbon metabolism
ppy01230  Biosynthesis of amino acids
Module
ppy_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ppy_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ppy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PPE_00112
  Energy metabolism
   00680 Methane metabolism
    PPE_00112
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PPE_00112
Enzymes [BR:ppy01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     PPE_00112
Membrane trafficking [BR:ppy04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    PPE_00112
Exosome [BR:ppy04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   PPE_00112
  Exosomal proteins of melanoma cells
   PPE_00112
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ADM68010
UniProt: E0R9F4
Position
142271..142816
Genome map
AA seq 181 aa AA seqDB search
MKKIYFVRHAQATGQEPDARLTDEGTRQAEQLADFMENVGVEYIVSSPWKRAVRTIQPLA
ERRQLQVYTDPRLQERVLSCEHLDHWLDVLEQTYLDEDLKLEGGESSREAVDRGIQLVQE
LIERAEKTVIIVTHGALLSLLIRHYDPRFGFEDWKKLSNPDVYLLELKEAEAKIHRVWNT
G
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaaaatttactttgtcagacatgcccaagcaaccggacaggaaccagatgcccgg
ctcaccgatgaaggtaccagacaagctgagcagttggctgattttatggagaatgtaggt
gtggaatatattgtgtccagcccatggaaacgggctgtgcgaaccattcagcccttggct
gagcgtagacagttgcaggtatatactgatccacgtcttcaggaacgtgtgcttagctgt
gagcatctggatcattggctggacgtgctggaacagacctatctggacgaggacttgaag
ctggagggaggggaatcatcccgtgaagcagtagatcgaggaatccagcttgttcaggag
cttatagagcgggcggaaaaaacggttatcattgtaactcatggagctttactatctctt
ctcattcgacattacgatccgcggtttgggtttgaggactggaaaaagctttcgaatccc
gacgtgtatttgctagaactgaaagaagcagaagccaagattcacagagtgtggaatacg
ggttga

DBGET integrated database retrieval system