KEGG   Paenibacillus polymyxa E681: PPE_00138Help
Entry
PPE_00138         CDS       T01319                                 

Gene name
murA1
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
ppy  Paenibacillus polymyxa E681
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ppy00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:ppy00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
171909..173162
Genome map
AA seq 417 aa AA seqDB search
MEKLMITGGRPLQGTVSISGAKNSAIALIPAAILAESEVILDNLPLLSDVAVYSEILEEL
GATVTWEGSQMKIDPSSIKSIPMPNGPVKKLRASYYMMGAMLGRFKEAIIGLPGGCNFEP
RPIDQHIKGFEALGATVTNEHGAIHLHAKELRGTKIYLDVSSVGATINIMLAAARAKGAT
IIENAAKEPEIIDVATLLNSMGAIIKGAGTETIRIEGVSELHGCRHSIIPDRIQAGTYMI
AAAATRGNVLIDNVIPKHMEALTAKMQEMGIGIEEYDESIRVLGAPSYEHVDVKALIYPG
FATDLQSPMTSLLTQAQGVSVLSDFVYSNRFKHVPELVRMGAKIRVEGRSAIIEGGQLNA
AKVKAADLRAGAALVIAGLTVSEGVTEVTGVEYIDRGYDHLVSNLRLLGADVWRQTE
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaattgatgatcaccggtggacggccgcttcaaggtacagtttccatcagcggt
gccaaaaacagtgccatcgccttgattcccgcagccattctggcagagtcggaagtcatt
ttggacaatttgccactgttgagtgatgtggcggtgtattccgaaatactggaggaactt
ggtgcaacggttacctgggaaggtagccagatgaaaatagatccttcctctattaaatcc
attcctatgccgaatgggcctgttaagaaattacgagcctcttattatatgatgggagcc
atgctgggcagattcaaggaagcgatcatcggtttgccaggagggtgcaatttcgaaccc
cggcccattgatcagcatatcaaaggttttgaagcgctgggagccacggttacgaacgag
cacggcgctattcatttgcacgccaaagaactgcgcggaaccaaaatttatttggatgtt
agcagcgtaggcgctaccattaatattatgctggcggcagcacgtgccaaaggcgccaca
attatcgaaaatgcggctaaagagcctgagattatagatgtagcaacccttttaaactcc
atgggggccattattaaaggcgccggtacggaaacgattcgaattgaaggtgtgtcggag
ctacatggctgccgtcattcgatcatacctgaccgtatacaagcaggcacatatatgatt
gccgctgcggcaacccgtggaaatgtattgattgacaacgtaatccccaaacatatggag
gctctcactgcaaaaatgcaggaaatgggcatcggcatcgaggaatatgatgaaagtatt
cgcgtactgggtgcaccttcctatgaacatgtcgacgttaaagccttgatataccctgga
ttcgccacagatttacaatctcccatgaccagcttgcttacccaagcacagggtgtcagt
gtattgagcgattttgtgtacagcaatcgttttaagcacgtccctgagctggtgcgaatg
ggggctaaaattcgcgtagagggtcggtccgctattatagagggtggtcaactgaatgca
gctaaagtaaaagcggcagatctgcgcgccggagcggcccttgtcattgctggacttaca
gtaagcgaaggcgtaaccgaggtgacgggtgtcgagtacattgaccgtggttatgatcac
cttgtctccaacctgcgtcttttgggcgcagatgtatggaggcagactgaataa

DBGET integrated database retrieval system