KEGG   Paenibacillus polymyxa E681: PPE_00145Help
Entry
PPE_00145         CDS       T01319                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
ppy  Paenibacillus polymyxa E681
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:ppy03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
179149..179748
Genome map
AA seq 199 aa AA seqDB search
MYYPEPIAKLIDAFTRLPGVGPKTAARLAFHVLKMKEDDVIDFAKALVNVKRNLHFCSVC
GNITDTDPCRICQDKTRDTSVICVVQDSKDLVAMERTKEFNGFYHVLHGAISPMEGIGPE
DIKLKELLNRLSDERVKELILATNPNIEGEATAMYISRLVRPFEIKVTRIAHGLPVGGDL
EYADEVTLSKALEGRRELN
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
ttgtattatccggagccgattgcaaagctaattgatgcttttacgcgcctgccgggagta
gggccgaagacggctgcccggttggcttttcacgtactgaaaatgaaggaagatgatgtg
attgactttgccaaagcgctggtcaatgtaaaacgcaatcttcacttctgttcagtctgc
ggcaacattacggacacagatccttgtcggatctgtcaggataagacgagggatacttct
gtcatttgtgttgttcaggattccaaggatttggtggctatggagcgtaccaaagagttt
aatggtttttaccatgtgcttcatggggcgatatctcctatggagggaattggtcctgag
gatatcaaactcaaggaattgctgaacagactcagtgatgaacgcgtcaaggagctgatt
ttagctacgaacccgaacattgaaggagaggccacggccatgtacatttctcggctagtg
cgtccttttgaaatcaaggttactcgtattgctcatggattgccggtgggcggagatttg
gagtatgccgacgaggttaccctgtccaaagcgttggaaggccgtagagagctcaattaa

DBGET integrated database retrieval system