KEGG   Paenibacillus polymyxa E681: PPE_00185Help
Entry
PPE_00185         CDS       T01319                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
ppy  Paenibacillus polymyxa E681
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ppy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PPE_00185
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PPE_00185
   00052 Galactose metabolism
    PPE_00185
   00500 Starch and sucrose metabolism
    PPE_00185
   00520 Amino sugar and nucleotide sugar metabolism
    PPE_00185
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PPE_00185
   00524 Butirosin and neomycin biosynthesis
    PPE_00185
Enzymes [BR:ppy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     PPE_00185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
209073..210023
Genome map
AA seq 316 aa AA seqDB search
MSESIYVGVDLGGTAIKVGICNENGQLLHTYEGPTETDKGVDVVIGNIEKYVRHIVEQSP
YEWDQLKGVGAGVAGFTNVRDGIIVLAPNIGFRDVPIRALLENRIGKPVKIDNDANVAAL
GEAWAGAGKGIENCVCYTLGTGVGGGIIINGKIYQGSSGMAGEIGHISVVPDLEAIQCGC
GKMGCLETVSSATGIIRMAKDAVERGDRTSLALEDQIAAKEVFDAAKAGDEVALRIVNRA
AFYLGKSMAAVAAVLNPELFIIGGGVSKAGDFLFEEMRRVYAKLAPEPLQKGVYIVPAVL
GNDAGIVGAAGLLLRS
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaagtatctatgtaggtgtcgatttgggcggtaccgcgattaaagtcggcatt
tgtaatgaaaacggacagcttttgcacacatatgagggaccaaccgaaaccgataaaggt
gtagacgttgtcatcggtaatatcgaaaaatatgtgcggcatattgttgagcaatctcct
tatgagtgggatcaactaaagggtgtcggtgcaggcgttgcaggttttacgaatgttcgt
gatggtattattgtcctcgctcctaatattggctttcgtgacgtaccgatccgtgcgctc
ctagagaaccggattggcaagcctgtgaaaatagacaacgatgcgaatgttgctgcgctg
ggtgaggcttgggctggtgcaggcaaaggtatcgaaaattgcgtgtgctataccctggga
acaggagtaggtggcggtattattataaacggcaaaatataccaaggttcttcgggcatg
gccggagaaattggccatatcagcgtcgtacctgatctggaggctattcagtgtggatgc
ggcaaaatgggttgcttggaaactgtatcttccgcaacaggcattattcgtatggccaag
gacgctgtggagcgtggcgaccggacctctctggcgctggaagatcaaattgctgccaag
gaagtatttgatgctgctaaagctggagatgaagtcgcgctgcgtatcgtgaaccgggct
gccttttatttggggaaatccatggcagcagttgccgctgtgcttaatccagagttgttt
attataggtggcggtgtttctaaagcaggcgactttttatttgaagagatgcgtcgcgta
tacgccaagctggcacctgaaccgcttcaaaagggtgtatatatcgtaccagcggtgtta
ggcaatgacgcaggtatcgtaggggctgcagggttgctgctacgctcctga

DBGET integrated database retrieval system