KEGG   Paenibacillus polymyxa E681: PPE_00197Help
Entry
PPE_00197         CDS       T01319                                 

Gene name
tpiA
Definition
Triosephosphate isomerase (Triose-phosphate isomerase) (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ppy  Paenibacillus polymyxa E681
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ppy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PPE_00197 (tpiA)
   01230 Biosynthesis of amino acids
    PPE_00197 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PPE_00197 (tpiA)
   00051 Fructose and mannose metabolism
    PPE_00197 (tpiA)
   00562 Inositol phosphate metabolism
    PPE_00197 (tpiA)
Enzymes [BR:ppy01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PPE_00197 (tpiA)
Exosome [BR:ppy04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PPE_00197 (tpiA)
  Exosomal proteins of bladder cancer cells
   PPE_00197 (tpiA)
  Exosomal proteins of melanoma cells
   PPE_00197 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
220503..221255
Genome map
AA seq 250 aa AA seqDB search
MRTPIIAGNWKMFKTVPEAKTFIEEIKGKAEVAGVESVICAPFTNLPALVEAVKGTSIKI
GAQNLHFAEDGAFTGEISGGMLKDLGVDYVVIGHSERREYFNETDETVNKKVHAAFRHGL
TPIVCVGEKLEDREAGQTKEVVKVQTVAAFAGLAKDQAAQVVVAYEPIWAIGTGKSSTSQ
DANEVISYIRSLIKELYDENTANAVRIQYGGSVKPENVTEYLGQSDIDGALVGGASLQPA
SYIALVEGAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
ttgagaacaccgattatcgcgggtaactggaagatgtttaaaaccgtaccagaagctaaa
actttcatcgaagagatcaaaggcaaagcagaggttgcaggagtggaaagcgtgatttgc
gcaccatttacgaatcttcctgctctggttgaagcagtaaaaggcacgtctattaaaatt
ggcgcacaaaacctgcactttgcagaagatggcgcatttacaggtgaaattagcggtgga
atgctgaaagatctgggcgtagactacgttgtgatcggacactccgagcgtcgtgaatat
tttaatgaaacagacgaaacggtgaacaaaaaggttcatgcggcattccgtcatggcctg
actccaatcgtatgtgtaggcgaaaagttggaagatcgtgaagctggacaaaccaaagag
gttgtaaaagtgcaaactgtagcagcttttgctggtttggctaaggatcaggctgcacaa
gtagttgttgcttatgagccaatctgggccatcggaacaggcaaatcctccacttcgcag
gatgcgaatgaagtgatttcctatatccgtagtctgattaaagagctgtatgatgaaaat
acagcaaatgctgtacgtattcagtatggtggcagtgtaaaacctgaaaatgttactgag
tacctgggtcaaagcgatatcgacggcgcgctcgtgggcggtgccagtcttcaaccggcg
tcgtacatcgcgcttgttgagggggcgaagtaa

DBGET integrated database retrieval system