KEGG   Paenibacillus polymyxa E681: PPE_00233Help
Entry
PPE_00233         CDS       T01319                                 

Definition
beta-galactosidase (lactase) (EC:3.2.1.23)
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
ppy  Paenibacillus polymyxa E681
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppy00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    PPE_00233
  Lipid metabolism
   00600 Sphingolipid metabolism
    PPE_00233
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    PPE_00233
Enzymes [BR:ppy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     PPE_00233
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(262870..265914)
Genome map
AA seq 1014 aa AA seqDB search
MTIQPPSLDWLTDVTKFAVHRLPAYSDHKYYATLQEAEQQADMAWRHSLNGSWKFNYATN
PASRPVEFYAPGFEYGGWSDIQVPGHIQTQGFGQMQYVNTMYPWDGHSDVRPPHIPEDHN
PVGSYIKSFVLPENMASDAQPVFISFQGVESAFYVWLNGQFVGYSEDSFTPSDFELTPFL
QAGENKLAVEVYQRSTGAWLEDQDFWRFSGIFRDVYLYTIPTVHVRDLHAKADLDASYTQ
GLLELKLTLEKPATAYATVDVKNAVGHVVASLKADFTDGTASLSATLEQVQSWSAEKPYL
YTLFIQIYDASGSLVEVIPQKIGFRKFELINKVMHLNGKRIVFKGVNRHEFNARTGRAIS
REDMLWDIRTLKQNNMNAVRTSHYPNQTLWYELCDEYGVYVIDEMNLETHGSWQKLGAVE
PSWNIPANLPEWQDIVMDRAISILERDKNHASILIWSCGNESYAGEVLRNVANYFRATDS
SRLVHYEGVFHNRTYDDTSDMESRMYAKPADIEQYLNDNPQKPYISCEYMHAMGNSVGGM
HKYTELENKYELYQGGFIWDYIDQAVMKKDRYGREYLAIGGDFDDRPTDYGFCTDGIVYA
DRKVSPKMQEVKFLYQNLKLSPDRSGVTIRNENLFEGTGDYELVYSLLHEGQEIARNVSH
VDVAAQTEAYIPLTFPSTDGKPGEYVIHTALVLKEATIWADAGHEVAFGQHIFIMEDSNP
LKAPTGGALRVVHGDVNIGVHGADFSIMFSKGAGSLTSLRYAGREMIATPPAPLFWRATT
DNDRGTALGFEAGGWFAASLTRKCVGIEVTEEQTDRVTVAFRYTLSIHADAKVTVAYTVF
ADGSLNVKSTYEGVPGLPNLPIFALSFKVPADYRHLDWYAMGPDENYIDRAFGARLGVFR
NEAADNVSGYVVPQESGNRTGVRRVDITDDSQRGIRITAPATAPVECNISPYTAFELESA
YHLYELPNVYYTVVTIAGKQMGVGGDDSWGAPVHEEYQITADQKLEFEFTMQRV
NT seq 3045 nt NT seq  +upstreamnt  +downstreamnt
ttgaccatccaaccccctagtctggactggctgaccgacgtaaccaaatttgctgtacat
cggctccccgcctattccgatcacaaatattacgctacgcttcaggaagcggagcagcaa
gctgatatggcttggcgccatagcctgaatgggagctggaaatttaactatgcaacgaat
ccagccagtcgtccggtagagttctatgcgcctgggtttgagtatggcggctggagcgat
attcaggtgccgggtcacattcagacacaaggctttggccaaatgcagtacgtgaatacg
atgtatccatgggacggacattcggacgttcgcccaccccatattccagaggatcacaac
ccagtcggaagctatatcaaaagctttgttttgccggaaaatatggcttccgacgcgcag
cctgtattcatttctttccaaggcgtcgagtcggctttctatgtatggctgaacggacaa
tttgtcggttacagtgaggatagctttacaccttctgatttcgaactgacaccgttcctg
caagcaggcgaaaacaagctggcggtagaggtatatcaaagaagtacgggagcatggctg
gaggatcaagacttttggcgtttttctggtattttcagagacgtatatctctataccatc
cctacggttcacgtacgtgacctgcatgccaaggcagatctggatgcttcctacacacag
ggccttctggagctgaaattgaccttggaaaaaccagcaactgcctatgcaactgtcgat
gtgaaaaatgctgtcggccatgttgtagcttctttgaaagctgactttacggatggcacc
gcttcgctgtcagcaaccttggagcaagtgcagagctggagcgcggagaaaccctatttg
tacacgttgttcattcaaatttatgatgccagtggatcgctcgtggaagtcattccacaa
aaaatcggcttccgtaaatttgagctgatcaacaaggtcatgcatttgaacggcaaacgc
atcgtctttaaaggtgtgaaccgccatgaatttaacgctcgcactggacgtgcgatttcc
cgtgaagatatgctgtgggatatccggacgctcaagcagaataatatgaacgctgtacgt
acctctcattacccgaatcagacactgtggtatgagctatgcgatgagtacggggtctat
gtaattgatgaaatgaacttggaaacacacggttcctggcaaaaacttggcgccgtcgag
ccatcctggaatattcccgctaatctgcctgagtggcaggatatcgttatggatcgcgcc
atttccatactggaacgggacaaaaaccatgcgtccattctgatctggtcctgcggaaat
gagtcgtatgcaggcgaagtgctgcgcaatgtagctaactatttccgagccaccgactcg
agtcgcttggtgcactacgaaggcgtgtttcacaaccgtacgtacgatgataccagcgat
atggagagccggatgtacgccaaacccgcagatatcgagcaatatctgaacgacaatccg
caaaaaccgtatatcagttgcgaatatatgcatgcaatgggtaattccgtaggcggcatg
cacaagtatactgagctggagaacaaatacgagctgtatcagggcggttttatttgggat
tacatcgatcaggcggtcatgaaaaaagatcgctacggacgcgagtacctcgcgatcggc
ggcgactttgacgaccgtccaacagactacggcttctgtacggacggaattgtctatgca
gatcggaaggtttcaccgaagatgcaggaggtcaaatttctgtatcaaaatctgaagctc
tctccggatcgtagcggcgtaactattcgcaacgaaaacctgttcgaaggaacgggggac
tacgagcttgtgtacagcctgctgcatgagggccaagagatcgcacgaaatgtgagtcat
gtagatgtggcggctcagaccgaagcctatattccattgacgttcccaagcacagacggg
aagcctggggaatatgtcattcacacggcgcttgtattgaaggaagcgacgatttgggcc
gacgctgggcatgaagtggccttcggacaacatattttcattatggaagattcaaacccg
ctgaaagctcctacaggtggagccctacgagtggtgcatggcgatgttaacattggcgtt
cacggtgcagatttcagtatcatgttctccaaaggagcaggtagcctgacttcacttcgc
tacgccggacgtgagatgatcgctacacctcctgctccattgttctggcgggcgaccaca
gacaatgatcggggaaccgcactgggctttgaagccggtggctggttcgctgcaagcctg
acgcgtaaatgcgtgggcatcgaggtcacggaagagcagacagaccgtgtaactgttgca
ttccgctacacgctgagcattcatgcggacgcaaaggtaacggtagcctataccgtcttc
gcagatggcagtctgaacgtaaaatcgacttatgaaggcgtcccagggctgcctaacctg
ccgatctttgccctttcgttcaaggttccagcggactaccgccatctggactggtatgcg
atgggaccggatgagaattacatcgaccgggcctttggcgcaagactaggtgtattccgg
aacgaagctgcggataacgtgtccgggtatgtcgtgccgcaggaatccggcaaccgtaca
ggcgtgcgccgtgtcgatattaccgacgattctcagcgtggtattcgcattactgcacca
gctaccgcacctgtggaatgcaatatttcgccgtatacagcgtttgagctagaaagtgcc
taccatctgtatgagctaccgaacgtgtattacaccgttgtcaccatagccggtaaacaa
atgggcgtaggcggcgacgatagctggggagctccggtacatgaagaataccaaattaca
gccgatcaaaagctggaattcgaatttaccatgcaacgagtataa

DBGET integrated database retrieval system