KEGG   Paenibacillus polymyxa E681: PPE_00278Help
Entry
PPE_00278         CDS       T01319                                 

Definition
alcohol dehydrogenase I (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
ppy  Paenibacillus polymyxa E681
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ppy00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    PPE_00278
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PPE_00278
  Lipid metabolism
   00071 Fatty acid degradation
    PPE_00278
  Amino acid metabolism
   00350 Tyrosine metabolism
    PPE_00278
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    PPE_00278
   00626 Naphthalene degradation
    PPE_00278
Enzymes [BR:ppy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     PPE_00278
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
314737..315753
Genome map
AA seq 338 aa AA seqDB search
MKAAIVTKDKKVSVEEKPLRSLKHGEALVQVEYCGVCHTDLHVKNADFGDVTGRVLGHEG
IGKVIELGEGVTSLKIGDRVSIAWMFQSCGHCEYCLTGRETLCREVKNAGYTVDGAMAEQ
CIVTADYAVKVPDSLDPAAASSVTCAGVTTYKAVKVSEIKPGQWIGIFGIGGLGNLAVQY
AKNVFNAKVVAFDISDEKLELAKKIGADYIVNSMKEDPVARAKELTNGAGLDATVVTAVA
KTPFNQAIDVVKAGARVVAVGLPTDKMDLDIPRLVLDGIQVIGSLVGTREDLKEAFQFAA
EGKVVPLVQKRPLEDINEIFEEMEQGKIQGRMVIDFTK
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcaattgttacaaaagacaagaaagttagtgtagaagagaaacctttacgc
tccctgaagcatggggaagcgttagtccaagttgaatactgcggagtttgccacacagat
ttacatgtaaaaaatgcagatttcggtgatgtcacaggcagagttctggggcatgaaggc
attggaaaagtcattgaattaggcgaaggagtaaccagtcttaagattggtgatcgcgta
agtattgcctggatgttccaaagctgtggtcattgcgaatattgcttaactggtcgggaa
acgctgtgccgtgaagtgaagaatgccggatatacggtagacggtgcaatggcagagcaa
tgtattgtcacagctgactacgcggtcaaagtaccagatagtcttgaccctgccgctgca
agcagtgtaacttgcgcaggggttacaacatataaagcagttaaagtaagtgaaatcaaa
ccaggacaatggatcggtatcttcggcattggcggcttgggtaacctggctgtgcaatac
gccaaaaatgtattcaatgctaaagttgtagcctttgacatcagtgatgaaaaactagaa
ctggccaaaaaaattggtgctgactatatcgttaacagcatgaaagaagatccggtcgct
cgagccaaggagttaacaaacggtgctggtctggatgcaaccgtggttactgctgttgcc
aaaacacctttcaaccaggccatcgacgttgtgaaggctggtgcgcgtgtcgtagctgta
ggtcttccaaccgataaaatggatctggatattccgcgtctggttctggacggtattcaa
gtgatcggctccttggtcggcactcgtgaagaccttaaagaagcgttccagttcgctgca
gaaggtaaagtcgtgcctcttgtacaaaaacgtccgctcgaagacattaatgaaatcttc
gaggagatggagcaaggcaaaatccaaggacgtatggtcattgatttcacaaaataa

DBGET integrated database retrieval system