KEGG   Paenibacillus polymyxa E681: PPE_00325Help
Entry
PPE_00325         CDS       T01319                                 

Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ppy  Paenibacillus polymyxa E681
Pathway
ppy00040  Pentose and glucuronate interconversions
ppy00052  Galactose metabolism
ppy00500  Starch and sucrose metabolism
ppy00520  Amino sugar and nucleotide sugar metabolism
ppy01100  Metabolic pathways
ppy01130  Biosynthesis of antibiotics
Module
ppy_M00362  Nucleotide sugar biosynthesis, prokaryotes
ppy_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ppy00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PPE_00325
   00052 Galactose metabolism
    PPE_00325
   00500 Starch and sucrose metabolism
    PPE_00325
   00520 Amino sugar and nucleotide sugar metabolism
    PPE_00325
Enzymes [BR:ppy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     PPE_00325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD Glycos_transf_2 CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: ADM68207
UniProt: E0RC32
Position
complement(368606..369487)
Genome map
AA seq 293 aa AA seqDB search
MRKITKAVIPAAGLGTRFLPATKALPKEMLPIVDKPAIQYIVEEAIKSGIESIIIVTGRN
KKAIEDHFDKSVELEQVLESKGKYDLLREVQSIGGKAVIHYIRQKEPLGLGHAVSCARQF
IGDEPFAVLLGDDIMNSSTPAIRQMMDVYEATGKQVVGVRTVEEQDVSKYGIIDSTHQNG
LIHEVGGLVEKPSPADAPSRQAVIGRYVLEPSIFSILENMSTGAGGEYQLTDALHQVALQ
NQLLALELEGTRYDIGDKAGYLEAVLHMGMQREDLRPMLDSMMREWALASMIK
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaattacaaaagctgttattccagccgccggattaggaacccgttttctacca
gctacgaaagctttaccgaaagagatgcttccaatcgtagacaagccggctattcaatat
atcgtagaagaagccatcaagtccggaattgagagcatcattatcgtaacggggcgtaat
aaaaaagccatcgaggatcattttgacaagtctgtggagttggagcaggtactggagagc
aagggtaaatatgatctcctacgtgaagttcaaagcatcgggggtaaagcagtcattcac
tatatccgtcaaaaagaacccctcggcctgggacatgcggtcagctgcgctcgtcagttc
attggcgatgagccctttgccgtgttgctgggcgatgatattatgaattcctccaccccg
gcgattcgtcaaatgatggatgtttacgaagcgactggcaagcaagtagtcggcgtgcgc
acagtggaagaacaagatgtgagtaaatacggcattattgactccactcaccagaacggt
ctcattcacgaagtcggcggacttgttgaaaaaccatctccggcagatgccccttcgcgg
caggcagtcattggtcggtatgtattggaaccttccattttctccatattggagaacatg
tccactggagcgggcggtgaataccaattgacggatgctctgcatcaagtagcattgcag
aaccaactgctcgcattagaactggaaggcacacgttatgatattggagataaagctgga
tatctggaagccgtgctccacatgggtatgcaacgcgaagatttgcgtccaatgcttgac
tccatgatgcgcgagtgggcgcttgcttcaatgataaaatag

DBGET integrated database retrieval system