KEGG   Paenibacillus polymyxa E681: PPE_00345Help
Entry
PPE_00345         CDS       T01319                                 

Definition
transcriptional regulator/sugar kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
ppy  Paenibacillus polymyxa E681
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ppy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PPE_00345
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PPE_00345
   00052 Galactose metabolism
    PPE_00345
   00500 Starch and sucrose metabolism
    PPE_00345
   00520 Amino sugar and nucleotide sugar metabolism
    PPE_00345
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PPE_00345
   00524 Butirosin and neomycin biosynthesis
    PPE_00345
Enzymes [BR:ppy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     PPE_00345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
393873..394835
Genome map
AA seq 320 aa AA seqDB search
MWGNKEVGVVAAAVNRVIGIDIGGTSVKAAIVARDGSVLDEIRLDTNASGGREWVLSRVS
ESVLGLLRPFGDTSIGAHIDVGALGIATAGRVNVESGEVVYATDNLPGWQGTSLVTWARE
KLALRAVADNDANAALLGEAWQGAGKGKRRLVMLTLGTGVGGAYMENGLLCRGAYWSGGD
WGHSILFPGGHPCNCGKKGCAEQYVSGSALLRRGREHVGKLYRSGNEIVKEAAHGNQEAI
QVLDDYTADLAVLLANISVTLDPEGIIVGGGVADAGEVWWPMLEKHLHQLGVQTEVSRAL
LGNRAGIIGAARLAFEMIES
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgtggggcaacaaggaggttggtgtggtggcagctgctgtgaacagagtcattggaatc
gacattgggggcacatcggtgaaggccgctatagtggcacgggacggatcggtgcttgat
gaaatccggctggatacgaacgcttccggtggacgtgaatgggtgttgtcgcgggtgtca
gaatctgtgctcggactgttacgtccttttggagataccagcatcggtgcccatatagat
gtaggcgctctaggcattgctactgctggccgagtaaatgtggagagcggcgaagttgtg
tatgccacagataacctacctggctggcaaggtacatccttagtaacgtgggcaagagaa
aaactggctttacgagcggttgctgataatgatgcgaacgctgctttacttggagaagcg
tggcagggagcggggaagggcaagcgacgcttggtgatgctcacgttgggaacaggtgtc
ggaggtgcatatatggaaaatggcctcttgtgcagaggggcttattggagcggcggtgat
tgggggcacagtattctattcccggggggacacccctgcaattgtggaaaaaaagggtgc
gccgagcaatatgtatcggggagcgccctgttacgtcgaggtagggaacacgtcggtaaa
ttgtaccgctcggggaacgagattgtgaaagaagccgctcacggtaaccaggaagcaatc
caggtgctggatgattacaccgcagatttagctgtgcttctggctaacatctcagtgact
cttgatcccgaggggatcattgtaggcggaggagtagcggacgccggagaggtctggtgg
cccatgctggaaaagcatctgcaccaacttggagttcaaacggaagtaagtcgggcattg
ttgggcaatcgtgctggaattatcggcgctgcacggcttgcttttgaaatgatcgagtcc
tag

DBGET integrated database retrieval system