KEGG   Paenibacillus polymyxa E681: PPE_00345Help
Entry
PPE_00345         CDS       T01319                                 

Definition
(GenBank) transcriptional regulator
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
ppy  Paenibacillus polymyxa E681
Pathway
ppy00010  Glycolysis / Gluconeogenesis
ppy00052  Galactose metabolism
ppy00500  Starch and sucrose metabolism
ppy00520  Amino sugar and nucleotide sugar metabolism
ppy00521  Streptomycin biosynthesis
ppy01100  Metabolic pathways
ppy01110  Biosynthesis of secondary metabolites
ppy01120  Microbial metabolism in diverse environments
ppy01130  Biosynthesis of antibiotics
ppy01200  Carbon metabolism
Module
ppy_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ppy_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ppy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PPE_00345
   00052 Galactose metabolism
    PPE_00345
   00500 Starch and sucrose metabolism
    PPE_00345
   00520 Amino sugar and nucleotide sugar metabolism
    PPE_00345
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PPE_00345
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    PPE_00345
Enzymes [BR:ppy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     PPE_00345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG FGGY_N Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: ADM68227
UniProt: E0RC52
Position
393897..394835
Genome map
AA seq 312 aa AA seqDB search
MVAAAVNRVIGIDIGGTSVKAAIVARDGSVLDEIRLDTNASGGREWVLSRVSESVLGLLR
PFGDTSIGAHIDVGALGIATAGRVNVESGEVVYATDNLPGWQGTSLVTWAREKLALRAVA
DNDANAALLGEAWQGAGKGKRRLVMLTLGTGVGGAYMENGLLCRGAYWSGGDWGHSILFP
GGHPCNCGKKGCAEQYVSGSALLRRGREHVGKLYRSGNEIVKEAAHGNQEAIQVLDDYTA
DLAVLLANISVTLDPEGIIVGGGVADAGEVWWPMLEKHLHQLGVQTEVSRALLGNRAGII
GAARLAFEMIES
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
gtggtggcagctgctgtgaacagagtcattggaatcgacattgggggcacatcggtgaag
gccgctatagtggcacgggacggatcggtgcttgatgaaatccggctggatacgaacgct
tccggtggacgtgaatgggtgttgtcgcgggtgtcagaatctgtgctcggactgttacgt
ccttttggagataccagcatcggtgcccatatagatgtaggcgctctaggcattgctact
gctggccgagtaaatgtggagagcggcgaagttgtgtatgccacagataacctacctggc
tggcaaggtacatccttagtaacgtgggcaagagaaaaactggctttacgagcggttgct
gataatgatgcgaacgctgctttacttggagaagcgtggcagggagcggggaagggcaag
cgacgcttggtgatgctcacgttgggaacaggtgtcggaggtgcatatatggaaaatggc
ctcttgtgcagaggggcttattggagcggcggtgattgggggcacagtattctattcccg
gggggacacccctgcaattgtggaaaaaaagggtgcgccgagcaatatgtatcggggagc
gccctgttacgtcgaggtagggaacacgtcggtaaattgtaccgctcggggaacgagatt
gtgaaagaagccgctcacggtaaccaggaagcaatccaggtgctggatgattacaccgca
gatttagctgtgcttctggctaacatctcagtgactcttgatcccgaggggatcattgta
ggcggaggagtagcggacgccggagaggtctggtggcccatgctggaaaagcatctgcac
caacttggagttcaaacggaagtaagtcgggcattgttgggcaatcgtgctggaattatc
ggcgctgcacggcttgcttttgaaatgatcgagtcctag

DBGET integrated database retrieval system