KEGG   Paenibacillus polymyxa E681: PPE_00551Help
Entry
PPE_00551         CDS       T01319                                 

Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
ppy  Paenibacillus polymyxa E681
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:ppy00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    PPE_00551
  Lipid metabolism
   00561 Glycerolipid metabolism
    PPE_00551
   00600 Sphingolipid metabolism
    PPE_00551
Enzymes [BR:ppy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     PPE_00551
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
601970..604153
Genome map
AA seq 727 aa AA seqDB search
MGIIVQGQTGLFHLQSSGMSYIIQIVDGFPVHVYWGDRLKHRESMTDLLLHTSATAGLDR
LPQEYPQYGSGDFGNPAYQVELEDGTRITELKYDGYRIIKGKPSLTGLPAVYTENEDEAD
TLELELKDDFSGLKVVLLYTVFADRNVIARSARLSNAGAKNLRLLRALSASVDFSGKSDL
EFMYLSGAWAREGNITRKPILQGETRIDSKRGMSSHQLNPFAALVTRGTTESYGEVFGFS
LVYSGGFEAGAELDSFGSTRFNIGVNSFDFSWLLSPGESFQTPEAIMVYSGQGLGDMSRT
YHRLYRTRLCRGKYRDEERPILVNNWEATYFDFNADKLVSIAKEGAELGIELFVLDDGWF
GKRDSDNSSLGDWYEDRRKLPDGLADVANRINRLGLKFGLWFEPEMISPDSELYREHPDW
CLHVPGRRRSEARWQLVLDYTRKEVRDYIYDSLAAIFSSAPVSYVKWDMNRCLTEIGSAA
LPPERQSETAHRYVLGLYELLERVTTEFPHILFESCSSGGGRFDPGMLYYMPQVWTSDNT
DAVERLKIQYGTSLVYPVSATGAHVSAVPNHQVGRITPLDFRGDVAMSGNFGYELDLTKF
TDEEKETVKRQIAVYKQIRGLVQKGDLYRLKSPFEDNESAWMFVSEDQEDAIVYYFQVMA
VPNAPWRALRLDGLNPELEYEVKSGNSGQKSIHGGDRLMKLGLPLLYRQKDYESGWFRLR
ALRSNKA
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgggtatcattgttcaagggcaaacggggctgtttcatctacagtcgtcgggcatgagc
tatattattcagattgtggatggatttcctgtgcatgtatattggggagataggctgaag
caccgcgaatcaatgaccgatctattgcttcacacttctgcgacggctggattggatcgg
ctaccgcaagagtacccgcagtatgggagtggagacttcggtaacccggcgtatcaagta
gaacttgaagatggaactcgtatcaccgagttaaagtacgatggttaccggatcatcaag
ggaaagccatcattaaccgggcttccggccgtatataccgagaatgaagacgaagcagat
acgttggaactggagttaaaagatgacttttcaggtcttaaagttgttcttctttacacc
gtcttcgcggatcgaaacgtaatcgctcgttcggctcgtttgagtaatgcgggagccaag
aaccttcggcttctccgtgctctaagtgccagtgtcgatttttcaggtaaaagcgatttg
gagttcatgtatctttcgggagcatgggctcgggaggggaatattacccgcaaaccgatt
cttcaaggtgaaacccgaattgatagtaaaaggggtatgagcagccatcaactcaaccct
tttgctgcattggtcactcggggaacaacggaaagctatggtgaggtattcggctttagc
ctcgtgtacagcgggggctttgaggcgggagcggagttagactcatttggctctacacgt
tttaacatcggcgtgaactcctttgacttttcgtggttactgagcccaggggagagcttc
caaacgccagaagcaattatggtttactccggtcaagggctgggagatatgtcgcggacg
tatcatcgcttgtatcggactcgactttgccgagggaaatatcgggatgaagaacgccct
attctggtcaataactgggaagctacctattttgacttcaatgcagataagctggtatcg
atagcgaaggagggggctgagctaggcatcgaactatttgtcttagatgatggttggttc
ggaaaacgggattctgacaattcgtctctcggtgattggtacgaggatcgtcggaagctg
ccagacggactcgcggatgtcgcgaaccgtatcaatcggctgggccttaagttcgggctc
tggtttgagccagagatgatctctccagacagtgagttgtaccgggagcatccagattgg
tgccttcacgttccaggacggcgacgcagtgaagccagatggcagctagtgctggactat
actcgcaaggaagtacgcgattacatctatgattcgctggctgccattttctccagcgcc
ccagtttcttacgtgaaatgggatatgaatcgctgcctgacggaaatcggttccgcagct
ctgccgccggagcgccaatctgagactgcccatcgctatgttcttggattgtatgagctg
ctggagcgcgtcaccaccgaatttccgcatattcttttcgagagctgttcaagtggcgga
ggacgttttgacccaggcatgctttactacatgcctcaagtctggactagtgataatacc
gatgcggtggaacgcctgaagattcaatatggaactagccttgtctatcctgtaagcgcc
accggagcgcatgtgtcagcagttccgaaccatcaagttggacgcataacaccccttgat
tttcgaggtgatgtggccatgtccggaaattttggatatgagcttgatctcacgaaattc
accgatgaggaaaaagagacggtcaaacgccaaatcgcagtatataagcagatacgtggc
ttagtacagaaaggtgacttgtatcgcctaaagagcccgtttgaagataacgaatcggct
tggatgtttgtttctgaagaccaagaggatgccatcgtctactatttccaagtgatggct
gttccgaacgcaccttggcgagccctgcgccttgacggactaaatccagagctcgaatat
gaagttaagtcaggaaatagcgggcaaaagtctatccatgggggggatcggcttatgaag
ttgggcctccctcttctctacagacagaaagactatgaaagtggatggttcaggcttcgg
gcattaaggtccaacaaggcttaa

DBGET integrated database retrieval system